StarFunc result for job id Q13402

User Input

>input (2215 residues)
MVILQQGDHVWMDLRLGQEFDVPIGAVVKLCDSGQVQVVDDEDNEHWISPQNATHIKPMH
PTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIR
QYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKS
RVCRQALDERNYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYAN
IRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLE
VNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYK
PPSQDVKNSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLE
SIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIP
PKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMG
AETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSG
MMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQ
IGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRG
HNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAV
LTVQAYARGMIARRLHQRLRAEYLWRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQER
LAQLAREDAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLGTSGGLPGQE
GQAPSGFEDLERGRREMVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRR
PLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGK
KTYKRELQALQGEGEAQLPEGQKKSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGN
SMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVG
CFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIML
PVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVM
DAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGEY
RCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHK
KGIYAQRRTDAQKVKEDVVSYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYF
VDEQEQVLLELSFPEIMAVSSSRECRVWLSLGCSDLGCAAPHSGWAGLTPAGPCSPCWSC
RGAKTTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGE
ESGFLSFAKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDSVYVMPTVTMPPREI
VALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARG
KDRLWSHTREPLKQALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIF
EGPLKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQS
RKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVES
STKAKDFCQNIATRLLLKSSEGFSLFVKIADKVLSVPENDFFFDFVRHLTDWIKKARPIK
DGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGAL
IYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAF
LKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNW
SSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286Y9F5	0.349	0.352	0.000	2190	0.835	0.845	A0A286Y9F5.pdb.gz
2	AFDB:P91443	0.413	0.432	0.000	2098	0.497	0.525	P91443.pdb.gz	HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1
3	AFDB:P97479	0.343	0.343	0.000	2215	0.965	0.965	P97479.pdb.gz	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
4	AFDB:Q6PIF6	0.335	0.350	0.000	2116	0.523	0.547	Q6PIF6.pdb.gz	MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2
5	AFDB:Q8CJE3	0.361	0.367	0.000	2177	0.944	0.960	Q8CJE3.pdb.gz	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
6	AFDB:Q99MZ6	0.361	0.378	0.000	2113	0.514	0.539	Q99MZ6.pdb.gz	MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus OX=10090 GN=Myo7b PE=1 SV=3
7	AFDB:Q9U1M8	0.304	0.287	0.000	2357	0.284	0.267	Q9U1M8.pdb.gz	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
8	AFDB:Q9V3Z6	0.363	0.370	0.000	2167	0.615	0.629	Q9V3Z6.pdb.gz	MYO7A_DROME Myosin-VIIa OS=Drosophila melanogaster OX=7227 GN=ck PE=1 SV=1
9	AFDB:I3ITL5	0.326	0.352	3.853E-91	2041	0.249	0.270	I3ITL5.pdb.gz	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
10	AFDB:F8VQB6	0.324	0.347	1.068E-86	2062	0.250	0.268	F8VQB6.pdb.gz	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
11	PDB:4anjA	0.289	0.623	2.698E-53	995	0.122	0.272	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
12	PDB:4pa0B	0.278	0.636	1.006E-52	920	0.127	0.307	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0A	0.275	0.599	1.095E-52	974	0.129	0.293	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:4p7hB	0.279	0.620	1.428E-49	952	0.123	0.287	4p7hB.pdb.gz
15	PDB:6ycxB	0.303	0.778	7.478E-49	817	0.102	0.277	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
16	PDB:7mf3B	0.313	0.733	9.966E-44	896	0.147	0.363	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.305	0.655	1.641E-42	954	0.144	0.333	5tbyA.pdb.gz
18	PDB:4rm8A	0.112	0.552	3.856E-10	368	0.024	0.144	4rm8A.pdb.gz
19	PDB:7c3mA	0.097	0.330	2.199E-5	577	0.025	0.097	7c3mA.pdb.gz
20	PDB:6r9tA	0.074	0.075	3.659E-5	2185	0.020	0.021	6r9tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MQX1	634	2069	0.167	0.178	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
2	A0A8I5ZWB0	4361	2238	0.942	0.933	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
3	A0A8J8XYU9	4466	2215	0.960	0.960	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
4	F8VQB6	641	2062	0.167	0.180	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
5	I3ITL5	615	2041	0.150	0.163	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
6	P79114	643	2052	0.169	0.182	MYO10_BOVIN Unconventional myosin-X OS=Bos taurus OX=9913 GN=MYO10 PE=1 SV=1
7	P91443	1251	2098	0.304	0.321	HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1
8	P97479	4489	2215	0.966	0.966	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
9	Q13402	4630	2215	1.000	1.000	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
10	Q6PIF6	2334	2116	0.528	0.552	MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2
11	Q7YU72	895	1035	0.207	0.443	Q7YU72_DROME RH39293p OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1
12	Q8CJE3	4371	2177	0.944	0.961	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
13	Q8IPH6	897	1033	0.208	0.445	Q8IPH6_DROME FI20293p1 OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=2
14	Q8IPH7	895	1034	0.207	0.444	Q8IPH7_DROME Myosin 28B1, isoform C OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=2
15	Q8IPH8	1570	2122	0.419	0.437	Q8IPH8_DROME Myosin 28B1, isoform B OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=1
16	Q99MZ6	2320	2113	0.520	0.545	MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus OX=10090 GN=Myo7b PE=1 SV=3
17	Q9DGG9	3918	2179	0.837	0.850	Q9DGG9_DANRE Myosin VIIA OS=Danio rerio OX=7955 GN=myo7A PE=2 SV=1
18	Q9HD67	645	2058	0.167	0.179	MYO10_HUMAN Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=3
19	Q9NH54	1571	2121	0.419	0.438	Q9NH54_DROME Myosin VIIB OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1
20	Q9U1M8	676	2357	0.172	0.162	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.1e+02	14.6	AAA ATPase domain
2	PF13401 AAA_22	60	15.4	AAA domain
3	PF00373 FERM_M	3.6e-16	71.0	FERM central domain
4	PF09379 FERM_N	1.6	20.0	FERM N-terminal domain
5	PF00612 IQ	1.7e-11	53.8	IQ calmodulin-binding motif
6	PF00063 Myosin_head	1e-236	799.1	Myosin head (motor domain)
7	PF00784 MyTH4	1.4e-53	191.2	MyTH4 domain
8	PF00640 PID	4.4e+02	12.3	Phosphotyrosine interaction domain (PTB/PID)
9	PF00788 RA	2.7e+02	13.6	Ras association (RalGDS/AF-6) domain
10	PF00018 SH3_1	39	15.3	SH3 domain
11	PF14604 SH3_9	1.2	20.4	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386331

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005226	0.999	Harmonin
2	9606.ENSP00000363068	0.989	Protocadherin-15
3	9606.ENSP00000381768	0.984	Cadherin-23
4	9606.ENSP00000410083	0.981	Vezatin
5	9606.ENSP00000301972	0.946	Rab effector MyRIP
6	9606.ENSP00000354623	0.941	Whirlin
7	9606.ENSP00000480279	0.925	Usher syndrome type-1G protein
8	9606.ENSP00000480489	0.891	PDZ domain-containing protein 7
9	9606.ENSP00000305941	0.871	Usherin
10	9606.ENSP00000384582	0.866	G-protein coupled receptor 98
11	9606.ENSP00000258930	0.855	Calcium and integrin-binding family member 2
12	9606.ENSP00000329158	0.831	Clarin-1
13	9606.ENSP00000367059	0.802	Espin
14	9606.ENSP00000302216	0.800	Protein atonal homolog 1
15	9606.ENSP00000261769	0.792	Cadherin-1
16	9606.ENSP00000311825	0.791	C-terminal-binding protein 2
17	9606.ENSP00000171111	0.784	Kelch-like ECH-associated protein 1
18	9606.ENSP00000297784	0.775	Transmembrane channel-like protein 1
19	9606.ENSP00000230732	0.755	POU domain, class 4, transcription factor 3
20	9606.ENSP00000272371	0.745	Otoferlin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000146	1.000	microfilament motor activity
GO:0044877	0.999	protein-containing complex binding
GO:0003779	0.998	actin binding
GO:0035639	0.997	purine ribonucleoside triphosphate binding
GO:0032555	0.997	purine ribonucleotide binding
GO:0042802	0.996	identical protein binding
GO:0005516	0.992	calmodulin binding
GO:0005524	0.992	ATP binding
GO:0043531	0.987	ADP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.912	multicellular organismal process
GO:0030029	0.791	actin filament-based process
GO:0071840	0.691	cellular component organization or biogenesis
GO:0030048	0.682	actin filament-based movement
GO:0016043	0.674	cellular component organization
GO:0032502	0.637	developmental process
GO:0048856	0.617	anatomical structure development
GO:0003008	0.589	system process
GO:0050877	0.528	nervous system process
GO:0007600	0.488	sensory perception
GO:0050896	0.480	response to stimulus
GO:0007275	0.379	multicellular organism development
GO:0050954	0.342	sensory perception of mechanical stimulus
GO:0051179	0.337	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.997	cytoskeleton
GO:0120025	0.996	plasma membrane bounded cell projection
GO:0032991	0.994	protein-containing complex
GO:0016020	0.992	membrane
GO:0043227	0.992	membrane-bounded organelle
GO:0015629	0.987	actin cytoskeleton
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005829	0.971	cytosol
GO:0016459	0.964	myosin complex
GO:0032421	0.955	stereocilium bundle
GO:0016461	0.953	unconventional myosin complex
GO:0071944	0.886	cell periphery
GO:0005886	0.814	plasma membrane
GO:0031982	0.808	vesicle
GO:0098858	0.609	actin-based cell projection
GO:0043005	0.456	neuron projection
GO:0005576	0.387	extracellular region
GO:0097733	0.382	photoreceptor cell cilium
GO:0070013	0.378	intracellular organelle lumen
GO:0031981	0.340	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	1.000	myosin ATPase.

[back to server]