StarFunc result for job id Q13404

User Input

>input (147 residues)
MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIY
ENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVV
LQELRRLMMSKENMKLPQPPEGQCYSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I3L0A0	0.942	0.375	2.154E-29	370	0.946	0.376	I3L0A0.pdb.gz	I3L0A0_HUMAN HCG2044781 OS=Homo sapiens OX=9606 GN=PEDS1-UBE2V1 PE=1 SV=1
2	AFDB:A0M8W4	0.958	0.971	2.534E-28	145	0.891	0.903	A0M8W4.pdb.gz	A0M8W4_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=2 SV=1
3	AFDB:F1R1E9	0.956	0.863	1.820E-27	163	0.884	0.798	F1R1E9.pdb.gz
4	PDB:7bbdA	0.935	0.922	9.924E-25	149	0.884	0.872	7bbdA.pdb.gz	RING domains act as both substrate and enzyme in a catalytic arrangement to drive self-anchored ubiquitination.
5	PDB:2hlwA	0.898	0.781	1.073E-22	170	0.952	0.824	2hlwA.pdb.gz
6	AFDB:Q9VRL1	0.965	0.978	1.436E-22	145	0.660	0.669	Q9VRL1.pdb.gz	Q9VRL1_DROME GEO06356p1 OS=Drosophila melanogaster OX=7227 GN=Uev1A PE=1 SV=1
7	AFDB:Q9SVD7	0.954	0.961	6.966E-21	146	0.517	0.521	Q9SVD7.pdb.gz	UEV1D_ARATH Ubiquitin-conjugating enzyme E2 variant 1D OS=Arabidopsis thaliana OX=3702 GN=UEV1D PE=1 SV=1
8	AFDB:F4J6Z1	0.946	0.849	2.540E-20	164	0.524	0.470	F4J6Z1.pdb.gz	F4J6Z1_ARATH Ubiquitin E2 variant 1D-4 OS=Arabidopsis thaliana OX=3702 GN=UEV1D-4 PE=1 SV=1
9	AFDB:O45495	0.921	0.973	4.423E-20	139	0.626	0.662	O45495.pdb.gz	UB2V1_CAEEL Ubiquitin-conjugating enzyme E2 variant 1 OS=Caenorhabditis elegans OX=6239 GN=uev-1 PE=1 SV=1
10	AFDB:O74983	0.918	0.970	1.825E-19	139	0.476	0.504	O74983.pdb.gz	MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spm2 PE=1 SV=1
11	AFDB:Q9CAB6	0.932	0.863	1.941E-19	159	0.490	0.453	Q9CAB6.pdb.gz	UEV1B_ARATH Ubiquitin-conjugating enzyme E2 variant 1B OS=Arabidopsis thaliana OX=3702 GN=UEV1B PE=1 SV=1
12	AFDB:Q93YP0	0.936	0.872	3.379E-19	158	0.497	0.462	Q93YP0.pdb.gz	UEV1A_ARATH Ubiquitin-conjugating enzyme E2 variant 1A OS=Arabidopsis thaliana OX=3702 GN=UEV1A PE=1 SV=1
13	PDB:5ojwB	0.901	0.965	2.902E-17	137	0.463	0.496	5ojwB.pdb.gz
14	PDB:6cyrA	0.713	0.686	7.799E-9	153	0.211	0.203	6cyrA.pdb.gz
15	PDB:1i7kA	0.689	0.694	1.737E-8	146	0.238	0.240	1i7kA.pdb.gz
16	PDB:6d68A	0.707	0.656	2.674E-8	159	0.259	0.239	6d68A.pdb.gz
17	PDB:3bzhA	0.689	0.632	3.218E-8	161	0.238	0.217	3bzhA.pdb.gz
18	PDB:5aieB	0.703	0.690	3.639E-8	150	0.211	0.207	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
19	PDB:4x57C	0.684	0.676	4.378E-8	149	0.238	0.235	4x57C.pdb.gz
20	PDB:3ptfA	0.693	0.667	7.624E-8	153	0.218	0.209	3ptfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13404	1.94e-107	303	147	1.000	1.000	UB2V1_HUMAN Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2
2	Q9CZY3	1.88e-102	291	147	0.939	0.939	UB2V1_MOUSE Ubiquitin-conjugating enzyme E2 variant 1 OS=Mus musculus OX=10090 GN=Ube2v1 PE=1 SV=1
3	I3L0A0	3.46e-100	293	370	0.952	0.378	I3L0A0_HUMAN HCG2044781 OS=Homo sapiens OX=9606 GN=PEDS1-UBE2V1 PE=1 SV=1
4	Q3B7F0	1.54e-96	276	147	0.884	0.884	Q3B7F0_DANRE Ubiquitin-conjugating enzyme E2 variant 1 OS=Danio rerio OX=7955 GN=zgc:123326 PE=1 SV=1
5	A0M8W4	1.02e-93	269	145	0.891	0.903	A0M8W4_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=2 SV=1
6	Q15819	1.02e-93	269	145	0.891	0.903	UB2V2_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4
7	Q6PEH5	2.95e-93	268	145	0.884	0.897	UB2V2_DANRE Ubiquitin-conjugating enzyme E2 variant 2 OS=Danio rerio OX=7955 GN=ube2v2 PE=2 SV=1
8	Q7M767	7.50e-93	267	145	0.884	0.897	UB2V2_RAT Ubiquitin-conjugating enzyme E2 variant 2 OS=Rattus norvegicus OX=10116 GN=Ube2v2 PE=1 SV=3
9	Q9D2M8	1.20e-92	266	145	0.878	0.890	UB2V2_MOUSE Ubiquitin-conjugating enzyme E2 variant 2 OS=Mus musculus OX=10090 GN=Ube2v2 PE=1 SV=4
10	Q9VRL1	1.13e-74	221	145	0.660	0.669	Q9VRL1_DROME GEO06356p1 OS=Drosophila melanogaster OX=7227 GN=Uev1A PE=1 SV=1
11	O45495	1.68e-65	197	139	0.626	0.662	UB2V1_CAEEL Ubiquitin-conjugating enzyme E2 variant 1 OS=Caenorhabditis elegans OX=6239 GN=uev-1 PE=1 SV=1
12	Q9SVD7	4.95e-55	171	146	0.517	0.521	UEV1D_ARATH Ubiquitin-conjugating enzyme E2 variant 1D OS=Arabidopsis thaliana OX=3702 GN=UEV1D PE=1 SV=1
13	Q9SJ44	1.71e-54	170	145	0.524	0.531	UEV1C_ARATH Ubiquitin-conjugating enzyme E2 variant 1C OS=Arabidopsis thaliana OX=3702 GN=UEV1C PE=1 SV=1
14	Q93YP0	1.98e-51	162	158	0.497	0.462	UEV1A_ARATH Ubiquitin-conjugating enzyme E2 variant 1A OS=Arabidopsis thaliana OX=3702 GN=UEV1A PE=1 SV=1
15	O74983	2.48e-51	161	139	0.476	0.504	MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spm2 PE=1 SV=1
16	F4J6Z1	1.23e-50	160	164	0.517	0.463	F4J6Z1_ARATH Ubiquitin E2 variant 1D-4 OS=Arabidopsis thaliana OX=3702 GN=UEV1D-4 PE=1 SV=1
17	Q9CAB6	6.32e-50	159	159	0.490	0.453	UEV1B_ARATH Ubiquitin-conjugating enzyme E2 variant 1B OS=Arabidopsis thaliana OX=3702 GN=UEV1B PE=1 SV=1
18	P53152	2.24e-46	149	137	0.463	0.496	MMS2_YEAST Ubiquitin-conjugating enzyme variant MMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMS2 PE=1 SV=1
19	A0A1D8PFF9	3.36e-45	146	137	0.469	0.504	A0A1D8PFF9_CANAL E2 ubiquitin-conjugating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MMS2 PE=4 SV=1
20	Q57YD9	1.73e-10	58.2	172	0.245	0.209	Q57YD9_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.620 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	1.3e+02	14.3	RWD domain
2	PF00179 UQ_con	8.9e-15	66.0	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008570070.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008588120.1	0.994	Ubiquitin-conjugating enzyme E2 N
2	482537.XP_008582511.1	0.940	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008579441.1	0.923	SUMO-conjugating enzyme UBC9 isoform X1
4	482537.XP_008577062.1	0.917	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 30 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008588846.1	0.917	ubiquitin-60S ribosomal protein L40
6	482537.XP_008564149.1	0.876	Ubiquitin-conjugating enzyme E2 K
7	482537.XP_008569023.1	0.876	polyubiquitin-B
8	482537.XP_008572510.1	0.876	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 106 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
9	482537.XP_008569454.1	0.852	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 20 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
10	482537.XP_008571799.1	0.852	Ubiquitin-conjugating enzyme E2 B isoform X1
11	482537.XP_008573029.1	0.850	Ubiquitin-conjugating enzyme E2 L3
12	482537.XP_008573034.1	0.850	Ubiquitin-conjugating enzyme E2 L3-like
13	482537.XP_008580190.1	0.850	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins
14	482537.XP_008577384.1	0.849	E3 ubiquitin-protein ligase CHIP
15	482537.XP_008583767.1	0.849	TNF receptor-associated factor 6
16	482537.XP_008579069.1	0.845	Ubiquitin-conjugating enzyme E2 D3 isoform X1
17	482537.XP_008578367.1	0.842	Ubiquitin-conjugating enzyme E2 D1 isoform X1
18	482537.XP_008589503.1	0.836	Ubiquitin-conjugating enzyme E2 S
19	482537.XP_008567371.1	0.828	Baculoviral IAP repeat-containing protein 6 isoform X1
20	482537.XP_008577184.1	0.816	NEDD8-conjugating enzyme Ubc12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.990	ubiquitin-protein transferase activity
GO:0061650	0.779	ubiquitin-like protein conjugating enzyme activity
GO:0061631	0.698	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0000209	0.957	protein polyubiquitination
GO:0044260	0.932	cellular macromolecule metabolic process
GO:0065007	0.913	biological regulation
GO:0050789	0.901	regulation of biological process
GO:0070534	0.861	protein K63-linked ubiquitination
GO:0050794	0.805	regulation of cellular process
GO:0006139	0.768	nucleobase-containing compound metabolic process
GO:0006259	0.761	DNA metabolic process
GO:0048518	0.749	positive regulation of biological process
GO:0050896	0.679	response to stimulus
GO:0019222	0.644	regulation of metabolic process
GO:0031323	0.634	regulation of cellular metabolic process
GO:0060255	0.613	regulation of macromolecule metabolic process
GO:0051171	0.596	regulation of nitrogen compound metabolic process
GO:0080090	0.595	regulation of primary metabolic process
GO:0051716	0.584	cellular response to stimulus
GO:0048522	0.570	positive regulation of cellular process
GO:0006282	0.552	regulation of DNA repair
GO:1903320	0.478	regulation of protein modification by small protein conjugation or removal
GO:1903322	0.463	positive regulation of protein modification by small protein conjugation or removal
GO:0031325	0.439	positive regulation of cellular metabolic process
GO:0031398	0.415	positive regulation of protein ubiquitination
GO:0045935	0.370	positive regulation of nucleobase-containing compound metabolic process
GO:0048584	0.347	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.999	protein-containing complex
GO:0031974	0.999	membrane-enclosed lumen
GO:0005634	0.994	nucleus
GO:0070013	0.982	intracellular organelle lumen
GO:1902494	0.976	catalytic complex
GO:0140535	0.975	intracellular protein-containing complex
GO:0005737	0.975	cytoplasm
GO:0031981	0.973	nuclear lumen
GO:1990234	0.968	transferase complex
GO:0031982	0.891	vesicle
GO:0005829	0.876	cytosol
GO:0005654	0.857	nucleoplasm
GO:0031371	0.816	ubiquitin conjugating enzyme complex
GO:0043232	0.738	intracellular non-membrane-bounded organelle
GO:0005576	0.689	extracellular region
GO:0005615	0.389	extracellular space
GO:1903561	0.373	extracellular vesicle
GO:0070062	0.318	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.990	Transferases.
EC:2.3.2.23	0.698	E2 ubiquitin-conjugating enzyme.

[back to server]