StarFunc result for job id Q13409

User Input

>input (638 residues)
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREA
EALLQSMGLTPESPIVFSEYWVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDP
SVLQLHSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVA
PKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQ
INIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYN
NNEDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLW
DNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQD
SMELVHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPIT
GIHCHAAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNADYVYDVMWSPTHPALF
ACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVG
EQIAVPRNDEWARFGRTLAEINANRADAEEEAATRIPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13409	1.000	1.000	0.000	638	1.000	1.000	Q13409.pdb.gz	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3
2	AFDB:E7F6H7	0.722	0.735	2.533E-95	626	0.788	0.804	E7F6H7.pdb.gz	DCI2A_DANRE Dynein, cytoplasmic 1, intermediate chain 2a OS=Danio rerio OX=7955 GN=dync1i2a PE=3 SV=2
3	AFDB:F1SF88	0.691	0.708	7.022E-89	622	0.730	0.749	F1SF88.pdb.gz	F1SF88_PIG Dynein cytoplasmic 1 intermediate chain 1 OS=Sus scrofa OX=9823 GN=DYNC1I1 PE=1 SV=5
4	AFDB:Q24246	0.674	0.650	2.299E-71	663	0.494	0.475	Q24246.pdb.gz	DYIN_DROME Cytoplasmic dynein 1 intermediate chain OS=Drosophila melanogaster OX=7227 GN=sw PE=1 SV=3
5	PDB:6f1tp	0.532	0.831	1.501E-56	401	0.624	0.993	6f1tp.pdb.gz	Cryo-EM shows how dynactin recruits two dyneins for faster movement.
6	AFDB:M9NE47	0.483	0.637	1.778E-46	480	0.335	0.446	M9NE47.pdb.gz	M9NE47_DROME Sperm-specific dynein intermediate chain 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Sdic1 PE=3 SV=1
7	PDB:7kzmD	0.537	0.735	8.067E-28	456	0.152	0.213	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
8	AFDB:Q8IWG1	0.504	0.368	1.497E-26	891	0.193	0.138	Q8IWG1.pdb.gz	DNAI3_HUMAN Dynein axonemal intermediate chain 3 OS=Homo sapiens OX=9606 GN=DNAI3 PE=1 SV=1
9	PDB:6rlbD	0.503	0.706	7.753E-25	446	0.150	0.215	6rlbD.pdb.gz
10	PDB:7kzmE	0.494	0.653	2.202E-24	474	0.158	0.213	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
11	PDB:6rlbC	0.474	0.595	6.352E-21	494	0.149	0.192	6rlbC.pdb.gz
12	PDB:3cfvB	0.407	0.631	6.385E-20	393	0.108	0.176	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
13	PDB:2ybaB	0.424	0.676	1.378E-19	382	0.100	0.168	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
14	PDB:7vggA	0.422	0.848	2.139E-19	304	0.085	0.178	7vggA.pdb.gz
15	PDB:6zrdA	0.415	0.615	3.319E-19	411	0.100	0.156	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
16	PDB:3dm0A	0.416	0.395	3.507E-19	675	0.088	0.083	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
17	AFDB:Q5A9A6	0.348	0.294	3.592E-16	768	0.139	0.116	Q5A9A6.pdb.gz	Q5A9A6_CANAL SCF ubiquitin ligase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC4 PE=4 SV=1
18	AFDB:Q6S003	0.426	0.152	7.751E-16	1873	0.113	0.038	Q6S003.pdb.gz	KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum OX=44689 GN=kif8 PE=2 SV=1
19	AFDB:P16649	0.418	0.376	9.657E-16	713	0.146	0.130	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
20	AFDB:Q7Z4S6	0.396	0.158	1.350E-14	1674	0.160	0.061	Q7Z4S6.pdb.gz	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F6H7	0.0	1005	626	0.790	0.805	DCI2A_DANRE Dynein, cytoplasmic 1, intermediate chain 2a OS=Danio rerio OX=7955 GN=dync1i2a PE=3 SV=2
2	F1SF88	0.0	892	622	0.729	0.748	F1SF88_PIG Dynein cytoplasmic 1 intermediate chain 1 OS=Sus scrofa OX=9823 GN=DYNC1I1 PE=1 SV=5
3	O14576	0.0	980	645	0.771	0.763	DC1I1_HUMAN Cytoplasmic dynein 1 intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1I1 PE=1 SV=2
4	O88485	0.0	979	628	0.768	0.780	DC1I1_MOUSE Cytoplasmic dynein 1 intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync1i1 PE=1 SV=2
5	O88487	0.0	1233	612	0.939	0.979	DC1I2_MOUSE Cytoplasmic dynein 1 intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync1i2 PE=1 SV=1
6	Q13409	0.0	1330	638	1.000	1.000	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3
7	Q24246	0.0	609	663	0.506	0.487	DYIN_DROME Cytoplasmic dynein 1 intermediate chain OS=Drosophila melanogaster OX=7227 GN=sw PE=1 SV=3
8	Q29RQ3	0.0	941	608	0.748	0.785	DC1I1_BOVIN Cytoplasmic dynein 1 intermediate chain 1 OS=Bos taurus OX=9913 GN=DYNC1I1 PE=1 SV=1
9	Q62871	0.0	1295	638	0.972	0.972	DC1I2_RAT Cytoplasmic dynein 1 intermediate chain 2 OS=Rattus norvegicus OX=10116 GN=Dync1i2 PE=1 SV=1
10	Q63100	0.0	968	643	0.768	0.762	DC1I1_RAT Cytoplasmic dynein 1 intermediate chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1i1 PE=1 SV=1
11	Q9W5W4	1.67e-173	505	517	0.393	0.485	Q9W5W4_DROME Sperm-specific dynein intermediate chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Sdic1 PE=3 SV=2
12	M9NE47	5.46e-152	449	480	0.334	0.444	M9NE47_DROME Sperm-specific dynein intermediate chain 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Sdic1 PE=3 SV=1
13	O45087	1.52e-136	415	643	0.378	0.375	O45087_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dyci-1 PE=1 SV=1
14	P54703	1.32e-135	413	654	0.315	0.307	DYIN_DICDI Cytoplasmic dynein 1 intermediate chain OS=Dictyostelium discoideum OX=44689 GN=dicA PE=2 SV=2
15	Q5BDC6	9.92e-121	376	689	0.378	0.350	Q5BDC6_EMENI Cytoplasmic dynein intermediate chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudI PE=4 SV=1
16	O94518	3.79e-51	187	544	0.201	0.235	DIC1_SCHPO Dynein intermediate chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dic1 PE=1 SV=2
17	Q385R8	2.45e-32	135	655	0.177	0.173	Q385R8_TRYB2 Dynein intermediate chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2640 PE=4 SV=1
18	Q6GPB9	1.33e-31	133	742	0.171	0.147	DNAI4_XENLA Dynein axonemal intermediate chain 4 OS=Xenopus laevis OX=8355 GN=dnai4 PE=2 SV=1
19	F1QHZ6	1.96e-31	132	778	0.138	0.113	DNAI4_DANRE Dynein axonemal intermediate chain 4 OS=Danio rerio OX=7955 GN=dnai4 PE=2 SV=1
20	Q5XPS1	1.78e-28	124	1057	0.127	0.077	Q5XPS1_CHLRE Axonemal inner arm I1 intermediate chain dynein IC138 OS=Chlamydomonas reinhardtii OX=3055 GN=BOP5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	13	17.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF11540 Dynein_IC2	6.1e-12	56.5	Cytoplasmic dynein 1 intermediate chain 2
3	PF00400 WD40	0.0063	28.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380308

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258198	0.999	Cytoplasmic dynein 1 light intermediate chain 2
2	9606.ENSP00000348965	0.999	Cytoplasmic dynein 1 heavy chain 1
3	9606.ENSP00000349679	0.999	Dynein light chain roadblock-type 1
4	9606.ENSP00000354791	0.998	Dynactin subunit 1
5	9606.ENSP00000376297	0.996	Dynein light chain 1, cytoplasmic
6	9606.ENSP00000273130	0.994	Cytoplasmic dynein 1 light intermediate chain 1
7	9606.ENSP00000356056	0.993	Dynein light chain Tctex-type 1
8	9606.ENSP00000408910	0.988	Dynactin subunit 2
9	9606.ENSP00000367841	0.986	Dynein light chain Tctex-type 3
10	9606.ENSP00000477310	0.977	Dynein light chain 2, cytoplasmic
11	9606.ENSP00000358921	0.969	Alpha-centractin
12	9606.ENSP00000302936	0.966	Dynein light chain roadblock-type 2
13	9606.ENSP00000254286	0.958	Actin related protein 10 homolog
14	9606.ENSP00000300087	0.955	Dynactin subunit 5
15	9606.ENSP00000221114	0.944	Dynactin subunit 6
16	9606.ENSP00000380378	0.939	Platelet-activating factor acetylhydrolase IB subunit alpha
17	9606.ENSP00000263168	0.935	F-actin-capping protein subunit alpha-1
18	9606.ENSP00000320130	0.934	Cytoplasmic dynein 1 intermediate chain 1
19	9606.ENSP00000474032	0.934	Cytoplasmic dynein 2 light intermediate chain 1
20	9606.ENSP00000381167	0.931	Cytoplasmic dynein 2 heavy chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.969	regulation of cellular process
GO:0007017	0.946	microtubule-based process
GO:0032501	0.903	multicellular organismal process
GO:0048856	0.897	anatomical structure development
GO:0007275	0.881	multicellular organism development
GO:0050896	0.835	response to stimulus
GO:0051128	0.793	regulation of cellular component organization
GO:0007018	0.732	microtubule-based movement
GO:0048731	0.701	system development
GO:0009719	0.646	response to endogenous stimulus
GO:0070848	0.571	response to growth factor
GO:0071840	0.539	cellular component organization or biogenesis
GO:0071495	0.501	cellular response to endogenous stimulus
GO:0016043	0.489	cellular component organization
GO:0007399	0.473	nervous system development
GO:0051179	0.458	localization
GO:0048519	0.445	negative regulation of biological process
GO:0051641	0.438	cellular localization
GO:0006996	0.429	organelle organization
GO:0048523	0.429	negative regulation of cellular process
GO:0051234	0.428	establishment of localization
GO:0006810	0.301	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005737	0.999	cytoplasm
GO:0015630	0.997	microtubule cytoskeleton
GO:0005875	0.993	microtubule associated complex
GO:0043227	0.992	membrane-bounded organelle
GO:1902494	0.988	catalytic complex
GO:0030286	0.963	dynein complex
GO:0005829	0.918	cytosol
GO:0043231	0.716	intracellular membrane-bounded organelle
GO:0012505	0.697	endomembrane system
GO:0031982	0.437	vesicle
GO:0005813	0.416	centrosome
GO:0120025	0.415	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]