StarFunc result for job id Q13418

User Input

>input (452 residues)
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55222	0.962	0.962	7.786E-77	452	0.996	0.996	O55222.pdb.gz	ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus OX=10090 GN=Ilk PE=1 SV=2
2	AFDB:Q6PHD6	0.991	0.991	4.053E-74	452	0.867	0.867	Q6PHD6.pdb.gz	Q6PHD6_DANRE Integrin-linked protein kinase OS=Danio rerio OX=7955 GN=zgc:65842 PE=1 SV=1
3	AFDB:A0A0A0MTH3	0.585	0.548	3.381E-70	483	1.000	0.936	A0A0A0MTH3.pdb.gz	A0A0A0MTH3_HUMAN Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=1
4	AFDB:Q9TZC4	0.947	0.919	8.351E-56	466	0.580	0.562	Q9TZC4.pdb.gz	ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans OX=6239 GN=pat-4 PE=1 SV=1
5	AFDB:Q9NHC7	0.958	0.967	1.075E-55	448	0.593	0.598	Q9NHC7.pdb.gz	Q9NHC7_DROME Integrin-linked kinase OS=Drosophila melanogaster OX=7227 GN=Ilk PE=2 SV=1
6	AFDB:Q59H18	0.522	0.291	1.263E-26	835	0.277	0.150	Q59H18.pdb.gz	TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens OX=9606 GN=TNNI3K PE=1 SV=3
7	AFDB:Q86AT8	0.530	0.385	3.589E-24	638	0.241	0.171	Q86AT8.pdb.gz	SPKA_DICDI Stress-activated protein kinase alpha OS=Dictyostelium discoideum OX=44689 GN=spkA-1 PE=1 SV=1
8	AFDB:Q9XI87	0.531	0.547	1.577E-22	438	0.239	0.247	Q9XI87.pdb.gz	VIK_ARATH Serine/threonine-protein kinase VIK OS=Arabidopsis thaliana OX=3702 GN=VIK PE=1 SV=1
9	AFDB:Q93Z30	0.496	0.489	1.186E-21	459	0.239	0.235	Q93Z30.pdb.gz	Q93Z30_ARATH AT4g18950/F13C5_120 OS=Arabidopsis thaliana OX=3702 GN=BHP PE=1 SV=1
10	AFDB:Q54TA1	0.510	0.315	2.173E-21	749	0.197	0.119	Q54TA1.pdb.gz	DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum OX=44689 GN=drkC PE=3 SV=1
11	PDB:2h8hA	0.502	0.509	1.061E-15	445	0.166	0.169	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4btfA	0.484	0.525	1.173E-15	413	0.170	0.186	4btfA.pdb.gz
13	PDB:1k9aB	0.476	0.487	5.328E-15	441	0.157	0.161	1k9aB.pdb.gz
14	PDB:6lk5A	0.488	0.793	2.815E-14	265	0.128	0.219	6lk5A.pdb.gz
15	PDB:7mfdA	0.493	0.540	1.216E-13	410	0.148	0.163	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:4oauC	0.327	0.225	1.730E-13	692	0.190	0.124	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
17	PDB:4fl2A	0.483	0.398	6.107E-13	555	0.133	0.108	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
18	PDB:4k2rA	0.478	0.397	1.440E-12	551	0.124	0.102	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
19	PDB:6s73A	0.489	0.790	1.514E-12	269	0.095	0.160	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
20	PDB:8dksA	0.413	0.633	2.049E-12	283	0.155	0.247	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MTH3	0.0	928	483	1.000	0.936	A0A0A0MTH3_HUMAN Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=1
2	O55222	0.0	943	452	0.996	0.996	ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus OX=10090 GN=Ilk PE=1 SV=2
3	Q13418	0.0	946	452	1.000	1.000	ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=2
4	Q6PHD6	0.0	839	452	0.867	0.867	Q6PHD6_DANRE Integrin-linked protein kinase OS=Danio rerio OX=7955 GN=zgc:65842 PE=1 SV=1
5	Q99J82	0.0	943	452	0.996	0.996	ILK_RAT Integrin-linked protein kinase OS=Rattus norvegicus OX=10116 GN=Ilk PE=2 SV=1
6	Q9NHC7	0.0	568	448	0.593	0.598	Q9NHC7_DROME Integrin-linked kinase OS=Drosophila melanogaster OX=7227 GN=Ilk PE=2 SV=1
7	Q9TZC4	0.0	571	466	0.582	0.564	ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans OX=6239 GN=pat-4 PE=1 SV=1
8	Q9V400	0.0	576	448	0.600	0.605	Q9V400_DROME Integrin linked kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Ilk PE=1 SV=1
9	V9HWF0	0.0	946	452	1.000	1.000	V9HWF0_HUMAN Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=HEL-S-28 PE=2 SV=1
10	Q8RWL6	1.31e-38	149	570	0.190	0.151	STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana OX=3702 GN=STY17 PE=1 SV=1
11	Q54TA1	5.74e-38	149	749	0.197	0.119	DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum OX=44689 GN=drkC PE=3 SV=1
12	Q54H46	1.42e-37	147	642	0.173	0.121	DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum OX=44689 GN=drkA PE=3 SV=1
13	F4JTP5	1.93e-36	143	575	0.179	0.141	STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana OX=3702 GN=STY46 PE=1 SV=1
14	O22558	3.43e-35	139	546	0.186	0.154	STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana OX=3702 GN=STY8 PE=1 SV=2
15	Q5GIG6	1.04e-34	139	834	0.283	0.153	TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus OX=10090 GN=Tnni3k PE=2 SV=4
16	Q05609	1.67e-34	139	821	0.177	0.097	CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana OX=3702 GN=CTR1 PE=1 SV=1
17	F4HVH9	4.18e-34	137	765	0.173	0.102	F4HVH9_ARATH PAS domain-containing protein tyrosine kinase family protein OS=Arabidopsis thaliana OX=3702 GN=RAF11 PE=1 SV=1
18	Q59H18	4.34e-34	137	835	0.277	0.150	TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens OX=9606 GN=TNNI3K PE=1 SV=3
19	Q2MHE4	4.81e-34	133	390	0.179	0.208	HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1 OS=Arabidopsis thaliana OX=3702 GN=HT1 PE=1 SV=1
20	Q9C9U5	6.42e-34	137	1030	0.164	0.072	SIS8_ARATH Probable serine/threonine-protein kinase SIS8 OS=Arabidopsis thaliana OX=3702 GN=SIS8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.6e-16	71.2	Ankyrin repeat
2	PF12796 Ank_2	3.3e-17	74.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.4e-14	63.6	Ankyrin repeat
4	PF13637 Ank_4	5.6e-20	82.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.4e-18	77.2	Ankyrin repeats (many copies)
6	PF00069 Pkinase	7.9e-19	79.6	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	3.5e-35	133.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 34839.XP_005380221.1

Rank	PPI partner	STRING score	Description
1	34839.XP_005380359.1	0.999	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 2 bases in 1 codon
2	34839.XP_005379511.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
3	34839.XP_005400860.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 mRNAs, 26 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns
4	34839.XP_005398208.1	0.994	Integrin beta-1-like isoform X1
5	34839.XP_005410900.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 3 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
6	34839.XP_005379514.1	0.989	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
7	34839.XP_005396572.1	0.987	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
8	34839.XP_005397656.1	0.975	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 17 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
9	34839.XP_005374815.1	0.973	RAC-gamma serine/threonine-protein kinase isoform X1
10	34839.XP_005387024.1	0.967	Ras suppressor protein 1 isoform X1
11	34839.XP_005397281.1	0.959	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 14 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns
12	34839.XP_005383092.1	0.935	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	34839.XP_005392653.1	0.929	Phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
14	34839.XP_005376830.1	0.928	Fermitin family homolog 2
15	34839.XP_005398742.1	0.926	Phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
16	34839.XP_005386286.1	0.918	Rapamycin-insensitive companion of mTOR isoform X1
17	34839.XP_005380912.1	0.892	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns
18	34839.XP_005410793.1	0.890	Heat shock protein HSP 90-alpha isoform X1
19	34839.XP_005402305.1	0.889	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 26 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
20	34839.XP_005406919.1	0.889	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.927	catalytic activity
GO:0140096	0.899	catalytic activity, acting on a protein
GO:0016740	0.878	transferase activity
GO:0004672	0.825	protein kinase activity
GO:0004674	0.553	protein serine/threonine kinase activity
GO:0019899	0.364	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0048522	0.978	positive regulation of cellular process
GO:0050896	0.977	response to stimulus
GO:0009653	0.974	anatomical structure morphogenesis
GO:0051716	0.971	cellular response to stimulus
GO:0023051	0.971	regulation of signaling
GO:0010646	0.969	regulation of cell communication
GO:0048583	0.967	regulation of response to stimulus
GO:0031589	0.965	cell-substrate adhesion
GO:0007154	0.964	cell communication
GO:0023052	0.955	signaling
GO:0008152	0.935	metabolic process
GO:0007165	0.932	signal transduction
GO:0048869	0.927	cellular developmental process
GO:0032501	0.923	multicellular organismal process
GO:0071704	0.915	organic substance metabolic process
GO:0009966	0.906	regulation of signal transduction
GO:0030154	0.902	cell differentiation
GO:0016310	0.900	phosphorylation
GO:0051338	0.895	regulation of transferase activity
GO:0044238	0.894	primary metabolic process
GO:0007275	0.894	multicellular organism development
GO:0043549	0.894	regulation of kinase activity
GO:2000145	0.890	regulation of cell motility
GO:0001934	0.888	positive regulation of protein phosphorylation
GO:0043170	0.885	macromolecule metabolic process
GO:0044093	0.881	positive regulation of molecular function
GO:0048731	0.878	system development
GO:1901564	0.872	organonitrogen compound metabolic process
GO:0023056	0.872	positive regulation of signaling
GO:0010647	0.867	positive regulation of cell communication
GO:0048584	0.859	positive regulation of response to stimulus
GO:0042221	0.845	response to chemical
GO:1902533	0.841	positive regulation of intracellular signal transduction
GO:0043412	0.839	macromolecule modification
GO:0016043	0.820	cellular component organization
GO:0030155	0.819	regulation of cell adhesion
GO:0007229	0.819	integrin-mediated signaling pathway
GO:0018105	0.815	peptidyl-serine phosphorylation
GO:0007160	0.806	cell-matrix adhesion
GO:0045785	0.801	positive regulation of cell adhesion
GO:0048519	0.780	negative regulation of biological process
GO:0010941	0.771	regulation of cell death
GO:0010810	0.768	regulation of cell-substrate adhesion
GO:0051239	0.742	regulation of multicellular organismal process
GO:0048523	0.741	negative regulation of cellular process
GO:0042127	0.728	regulation of cell population proliferation
GO:0048468	0.728	cell development
GO:0051128	0.726	regulation of cellular component organization
GO:0043067	0.715	regulation of programmed cell death
GO:0006950	0.711	response to stress
GO:0010811	0.702	positive regulation of cell-substrate adhesion
GO:0065008	0.681	regulation of biological quality
GO:0042981	0.673	regulation of apoptotic process
GO:0034446	0.671	substrate adhesion-dependent cell spreading
GO:0051094	0.664	positive regulation of developmental process
GO:0030334	0.651	regulation of cell migration
GO:0007272	0.639	ensheathment of neurons
GO:0009888	0.631	tissue development
GO:0048646	0.613	anatomical structure formation involved in morphogenesis
GO:0045595	0.612	regulation of cell differentiation
GO:0048513	0.592	animal organ development
GO:0008366	0.591	axon ensheathment
GO:0042552	0.540	myelination
GO:0010468	0.520	regulation of gene expression
GO:0010556	0.515	regulation of macromolecule biosynthetic process
GO:0031326	0.498	regulation of cellular biosynthetic process
GO:0045597	0.493	positive regulation of cell differentiation
GO:0022008	0.467	neurogenesis
GO:0070887	0.462	cellular response to chemical stimulus
GO:0048729	0.451	tissue morphogenesis
GO:0019219	0.438	regulation of nucleobase-containing compound metabolic process
GO:0072359	0.409	circulatory system development
GO:0060429	0.356	epithelium development
GO:0009887	0.335	animal organ morphogenesis
GO:0002009	0.333	morphogenesis of an epithelium
GO:0030335	0.316	positive regulation of cell migration
GO:0061061	0.304	muscle structure development
GO:0051252	0.303	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005925	0.986	focal adhesion
GO:0005654	0.986	nucleoplasm
GO:0071944	0.981	cell periphery
GO:0016020	0.977	membrane
GO:0005886	0.974	plasma membrane
GO:0005737	0.943	cytoplasm
GO:0005829	0.860	cytosol
GO:0043228	0.329	non-membrane-bounded organelle
GO:0043232	0.319	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.878	Transferases.
EC:2.7.1.-	0.825	Phosphotransferases with an alcohol group as acceptor.

[back to server]