StarFunc result for job id Q13422

User Input

>input (519 residues)
MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVE
TQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCD
ICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNY
ACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVI
KEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYE
KENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPR
SNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAP
HARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIH
MGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13422	1.000	1.000	3.931E-92	519	1.000	1.000	Q13422.pdb.gz	IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
2	AFDB:O42410	0.258	0.258	3.806E-73	518	0.859	0.861	O42410.pdb.gz	IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus OX=9031 GN=IKZF1 PE=2 SV=1
3	AFDB:P81183	0.351	0.347	1.749E-43	526	0.516	0.510	P81183.pdb.gz	IKZF2_MOUSE Zinc finger protein Helios OS=Mus musculus OX=10090 GN=Ikzf2 PE=1 SV=2
4	AFDB:O08900	0.166	0.170	3.569E-43	507	0.524	0.536	O08900.pdb.gz	IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus OX=10090 GN=Ikzf3 PE=1 SV=2
5	AFDB:Q9UKT9	0.183	0.186	2.418E-41	509	0.520	0.530	Q9UKT9.pdb.gz	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
6	AFDB:Q9H5V7	0.189	0.228	7.287E-17	419	0.208	0.258	Q9H5V7.pdb.gz	IKZF5_HUMAN Zinc finger protein Pegasus OS=Homo sapiens OX=9606 GN=IKZF5 PE=1 SV=1
7	AFDB:Q6DBW0	0.192	0.233	8.297E-15	419	0.202	0.251	Q6DBW0.pdb.gz	IKZF5_DANRE Zinc finger protein Pegasus OS=Danio rerio OX=7955 GN=ikzf5 PE=2 SV=1
8	AFDB:H2L008	0.169	0.179	5.808E-14	480	0.179	0.194	H2L008.pdb.gz	ZTF16_CAEEL Zinc finger protein ztf-16 OS=Caenorhabditis elegans OX=6239 GN=ztf-16 PE=1 SV=1
9	AFDB:P07247	0.165	0.170	5.622E-13	502	0.164	0.169	P07247.pdb.gz	KRUP_DROME Protein krueppel OS=Drosophila melanogaster OX=7227 GN=Kr PE=1 SV=2
10	AFDB:Q8K2R5	0.158	0.134	1.307E-12	619	0.154	0.129	Q8K2R5.pdb.gz	ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus OX=10090 GN=Znf668 PE=2 SV=1
11	PDB:3w5kB	0.092	0.267	3.774E-5	110	0.071	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7o4iW	0.048	0.071	9.987E-1	312	0.083	0.138	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
13	PDB:4btsA9	0.048	0.154	1.910	93	0.021	0.118	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
14	PDB:5z56v	0.059	0.176	2.175	167	0.015	0.048	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
15	PDB:6ydhA	0.052	0.227	2.321	62	0.023	0.194	6ydhA.pdb.gz
16	PDB:3j79c	0.071	0.184	2.819	89	0.040	0.236	3j79c.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
17	PDB:5nrlU	0.050	0.127	2.819	196	0.019	0.051	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
18	PDB:3qagA	0.072	0.138	3.210	238	0.031	0.067	3qagA.pdb.gz	Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases.
19	PDB:4msxA	0.052	0.062	3.210	395	0.021	0.028	4msxA.pdb.gz	The crystal structure of S. cerevisiae Sad1, a catalytically inactive deubiquitinase that is broadly required for pre-mRNA splicing.
20	PDB:7z36B	0.056	0.062	3.654	446	0.052	0.061	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WU46	0.0	673	336	0.624	0.964	A0A087WU46_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
2	O42410	0.0	952	518	0.859	0.861	IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus OX=9031 GN=IKZF1 PE=2 SV=1
3	O93581	0.0	677	537	0.676	0.654	O93581_DANRE DNA-binding protein Ikaros OS=Danio rerio OX=7955 GN=znfn1a1 PE=2 SV=1
4	Q03267	0.0	970	517	0.921	0.925	IKZF1_MOUSE DNA-binding protein Ikaros OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=2
5	Q13422	0.0	1077	519	1.000	1.000	IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
6	Q5SWU0	0.0	716	428	0.671	0.813	Q5SWU0_MOUSE IKAROS family zinc finger 1 OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=1
7	Q9UKS7	0.0	520	526	0.536	0.529	IKZF2_HUMAN Zinc finger protein Helios OS=Homo sapiens OX=9606 GN=IKZF2 PE=1 SV=2
8	P81183	6.23e-180	518	526	0.528	0.521	IKZF2_MOUSE Zinc finger protein Helios OS=Mus musculus OX=10090 GN=Ikzf2 PE=1 SV=2
9	Q9UKT9	1.80e-178	513	509	0.511	0.521	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
10	A0A0A0MRA0	5.57e-175	494	249	0.455	0.948	A0A0A0MRA0_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
11	O08900	1.14e-174	503	507	0.539	0.552	IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus OX=10090 GN=Ikzf3 PE=1 SV=2
12	Q90W82	1.94e-172	500	563	0.538	0.496	Q90W82_CHICK IKAROS family zinc finger 2 OS=Gallus gallus OX=9031 GN=HELIOS PE=2 SV=1
13	F8VPL6	3.74e-167	486	540	0.518	0.498	F8VPL6_HUMAN IKAROS family zinc finger 4 OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=1
14	Q9H2S9	2.35e-166	485	585	0.518	0.460	IKZF4_HUMAN Zinc finger protein Eos OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=2
15	Q8C208	4.77e-165	482	586	0.514	0.456	IKZF4_MOUSE Zinc finger protein Eos OS=Mus musculus OX=10090 GN=Ikzf4 PE=1 SV=2
16	R9R4D9	6.69e-121	357	268	0.328	0.634	R9R4D9_HUMAN IKAROS family zinc finger 1 isoform 14 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
17	Q6DBW0	2.07e-34	136	419	0.250	0.310	IKZF5_DANRE Zinc finger protein Pegasus OS=Danio rerio OX=7955 GN=ikzf5 PE=2 SV=1
18	Q9H5V7	2.85e-30	124	419	0.189	0.234	IKZF5_HUMAN Zinc finger protein Pegasus OS=Homo sapiens OX=9606 GN=IKZF5 PE=1 SV=1
19	Q96GC6	1.52e-24	109	653	0.102	0.081	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2
20	I3L4J6	4.16e-24	107	435	0.127	0.152	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09237 GAGA	5.3e+02	12.0	GAGA factor
2	PF00096 zf-C2H2	1.9e-12	58.0	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	24	16.1	zinc-finger C2H2-type
4	PF13894 zf-C2H2_4	1.5e-06	39.6	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	2.3e+02	13.5	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	1.7e-15	67.8	Zinc-finger double domain
7	PF13909 zf-H2C2_5	3.4	18.8	C2H2-type zinc-finger domain
8	PF12874 zf-met	6.3e+02	12.2	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005549648.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005547708.1	0.943	Protein cereblon isoform X1
2	9541.XP_005569975.1	0.938	chromodomain-helicase-DNA-binding protein 4 isoform X1
3	9541.XP_005551686.1	0.913	LOW QUALITY PROTEIN: histone deacetylase 2-like
4	9541.XP_005544162.1	0.910	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
5	9541.XP_005584101.1	0.887	Ikaros family zinc finger protein 3
6	9541.XP_005554321.1	0.885	Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family
7	9541.XP_005578004.1	0.880	Uncharacterized protein
8	9541.XP_005560180.1	0.848	Transcriptional corepressor Sin3a
9	9541.XP_005595888.1	0.828	Uncharacterized protein
10	9541.XP_005566752.1	0.815	C-terminal-binding protein 2 isoform X1
11	9541.XP_005582858.1	0.815	chromodomain-helicase-DNA-binding protein 3 isoform X1
12	9541.XP_005540386.1	0.807	Receptor-type tyrosine-protein phosphatase C isoform X1
13	9541.XP_005544994.1	0.766	chromodomain-helicase-DNA-binding protein 5 isoform X1
14	9541.XP_005584742.1	0.763	Uncharacterized protein
15	9541.XP_005562637.1	0.748	Tyrosine-protein kinase Blk
16	9541.XP_005571224.1	0.741	Zinc finger protein Eos isoform X1
17	9541.XP_005567439.1	0.735	Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15 (By similarity).
18	9541.XP_005593949.1	0.732	Uncharacterized protein
19	9541.XP_005570013.1	0.728	Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR [...]
20	9541.XP_005578229.1	0.726	V(D)J recombination-activating protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.995	sequence-specific DNA binding
GO:0042802	0.890	identical protein binding
GO:0019904	0.780	protein domain specific binding
GO:0003690	0.750	double-stranded DNA binding
GO:1990837	0.484	sequence-specific double-stranded DNA binding
GO:0140110	0.368	transcription regulator activity
GO:0001067	0.304	transcription regulatory region nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0032502	0.980	developmental process
GO:0032501	0.975	multicellular organismal process
GO:0048856	0.971	anatomical structure development
GO:0009889	0.971	regulation of biosynthetic process
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0010468	0.940	regulation of gene expression
GO:0031323	0.918	regulation of cellular metabolic process
GO:0002376	0.917	immune system process
GO:0080090	0.895	regulation of primary metabolic process
GO:0045321	0.865	leukocyte activation
GO:0046649	0.850	lymphocyte activation
GO:0002521	0.846	leukocyte differentiation
GO:0030098	0.841	lymphocyte differentiation
GO:0019219	0.774	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.752	regulation of RNA metabolic process
GO:0031326	0.709	regulation of cellular biosynthetic process
GO:0006355	0.703	regulation of DNA-templated transcription
GO:0048518	0.664	positive regulation of biological process
GO:0048519	0.637	negative regulation of biological process
GO:0048523	0.570	negative regulation of cellular process
GO:0050896	0.494	response to stimulus
GO:0048522	0.452	positive regulation of cellular process
GO:0031324	0.436	negative regulation of cellular metabolic process
GO:0051172	0.432	negative regulation of nitrogen compound metabolic process
GO:0010605	0.424	negative regulation of macromolecule metabolic process
GO:0006357	0.351	regulation of transcription by RNA polymerase II
GO:0008152	0.329	metabolic process
GO:0009890	0.302	negative regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0032991	0.976	protein-containing complex
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:0000785	0.957	chromatin
GO:0005829	0.940	cytosol
GO:0016020	0.392	membrane
GO:0000792	0.338	heterochromatin
GO:0098687	0.308	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]