StarFunc result for job id Q13423

User Input

>input (1086 residues)
MANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVG
VPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVL
ASDLVVKVRAPMVNPTLGVHEADLLKTSGTLISFIYPAQNPELLNKLSQRKTTVLAMDQV
PRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGL
ASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAE
MKLFAQQCKEVDILISTALIPGKKAPVLFNKEMIESMKEGSVVVDLAAEAGGNFETTKPG
ELYIHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISPDKDNFYFDVKDDFDFGTMG
HVIRGTVVMKDGKVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMSTASAYT
AGLTGILGLGIAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAV
GGLALMGGHLYPSTTSQGLAALAAFISSVNIAGGFLVTQRMLDMFKRPTDPPEYNYLYLL
PAGTFVGGYLAALYSGYNIEQIMYLGSGLCCVGALAGLSTQGTARLGNALGMIGVAGGLA
ATLGVLKPGPELLAQMSGAMALGGTIGLTIAKRIQISDLPQLVAAFHSLVGLAAVLTCIA
EYIIEYPHFATDAAANLTKIVAYLGTYIGGVTFSGSLIAYGKLQGLLKSAPLLLPGRHLL
NAGLLAASVGGIIPFMVDPSFTTGITCLGSVSALSAVMGVTLTAAIGGADMPVVITVLNS
YSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRSLANVILGGYGTTSTAGG
KPMEISGTHTEINLDNAIDMIREANSIIITPGYGLCAAKAQYPIADLVKMLTEQGKKVRF
GIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINHDFPDTDLVLVIGANDTVNSAAQEDP
NSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPNTAMLLGDAKKTCDALQAKV
RESYQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13423	1.000	1.000	0.000	1086	1.000	1.000	Q13423.pdb.gz	NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=NNT PE=1 SV=3
2	AFDB:Q18031	0.923	0.962	0.000	1041	0.591	0.617	Q18031.pdb.gz	Q18031_CAEEL proton-translocating NAD(P)(+) transhydrogenase OS=Caenorhabditis elegans OX=6239 GN=nnt-1 PE=1 SV=2
3	AFDB:P07001	0.361	0.752	1.564E-44	510	0.246	0.524	P07001.pdb.gz	PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=pntA PE=1 SV=2
4	AFDB:Q9ALA2	0.358	0.719	5.733E-42	523	0.229	0.476	Q9ALA2.pdb.gz	PNTA_CERSP NAD(P) transhydrogenase subunit alpha OS=Cereibacter sphaeroides OX=1063 GN=pntA PE=1 SV=1
5	AFDB:P0AB67	0.403	0.933	7.701E-37	462	0.217	0.511	P0AB67.pdb.gz	PNTB_ECOLI NAD(P) transhydrogenase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=pntB PE=1 SV=1
6	AFDB:Q2RSB4	0.401	0.917	1.332E-33	464	0.196	0.459	Q2RSB4.pdb.gz	PNTB_RHORT NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=pntB PE=1 SV=1
7	AFDB:Q72GR8	0.327	0.929	1.845E-32	375	0.143	0.413	Q72GR8.pdb.gz	Q72GR8_THET2 NAD/NADP transhydrogenase alpha subunit 1 OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=TT_C1780 PE=1 SV=1
8	AFDB:Q2RSB2	0.337	0.933	2.839E-32	384	0.146	0.414	Q2RSB2.pdb.gz	PNTAA_RHORT NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=pntAA PE=1 SV=1
9	PDB:4j1tE	0.321	0.904	2.173E-31	373	0.142	0.413	4j1tE.pdb.gz	Crystal structure analysis of Thermus thermophilus transhydrogenase soluble domains
10	PDB:1f8gA	0.337	0.939	5.855E-31	382	0.150	0.427	1f8gA.pdb.gz	Protein-protein recognition, hydride transfer and proton pumping in the transhydrogenase complex.
11	PDB:1u2gB	0.315	0.929	8.266E-31	359	0.138	0.418	1u2gB.pdb.gz	Active-site conformational changes associated with hydride transfer in proton-translocating transhydrogenase.
12	AFDB:Q72GS0	0.399	0.941	1.373E-30	450	0.159	0.384	Q72GS0.pdb.gz	Q72GS0_THET2 NAD(P) transhydrogenase subunit beta OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=TT_C1778 PE=1 SV=1
13	AFDB:P96832	0.318	0.921	3.114E-30	366	0.134	0.399	P96832.pdb.gz	P96832_MYCTU Probable NAD(P) transhydrogenase (Subunit alpha) PntAa [first part catalytic part] (Pyridine nucleotide transhydrogenase subunit alpha) (Nicotinamide nucleotide transhydrogenase subunit alpha) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pntAa PE=1 SV=1
14	PDB:4o9uB	0.254	0.583	1.159E-25	440	0.157	0.389	4o9uB.pdb.gz	Structural biology. Division of labor in transhydrogenase by alternating proton translocation and hydride transfer.
15	PDB:2vhwE	0.275	0.738	5.204E-20	373	0.090	0.263	2vhwE.pdb.gz	Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
16	PDB:2vhyB	0.249	0.774	8.104E-16	330	0.080	0.264	2vhyB.pdb.gz
17	PDB:2q99A	0.213	0.552	5.737E-9	372	0.058	0.169	2q99A.pdb.gz
18	PDB:3jtmA	0.188	0.479	1.664E-5	351	0.056	0.174	3jtmA.pdb.gz	Structure of recombinant formate dehydrogenase from Arabidopsis thaliana
19	PDB:1ygyA	0.162	0.287	2.791E-5	527	0.043	0.089	1ygyA.pdb.gz
20	PDB:2fssA	0.185	0.440	3.316E-5	353	0.050	0.153	2fssA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A0P0	0.0	1837	1017	0.828	0.884	A0A8I6A0P0_RAT proton-translocating NAD(P)(+) transhydrogenase OS=Rattus norvegicus OX=10116 GN=Nnt PE=1 SV=1
2	A0A8I6AC81	0.0	1657	1022	0.789	0.839	A0A8I6AC81_RAT proton-translocating NAD(P)(+) transhydrogenase OS=Rattus norvegicus OX=10116 GN=Nnt PE=1 SV=1
3	A0A8I6ADT1	0.0	608	721	0.275	0.415	A0A8I6ADT1_RAT proton-translocating NAD(P)(+) transhydrogenase OS=Rattus norvegicus OX=10116 GN=Nnt PE=1 SV=1
4	A0A8I6ALS9	0.0	1000	835	0.451	0.587	A0A8I6ALS9_RAT proton-translocating NAD(P)(+) transhydrogenase OS=Rattus norvegicus OX=10116 GN=Nnt PE=1 SV=1
5	A0A8I6AQG5	0.0	2062	1141	0.931	0.886	A0A8I6AQG5_RAT proton-translocating NAD(P)(+) transhydrogenase OS=Rattus norvegicus OX=10116 GN=Nnt PE=1 SV=1
6	Q13423	0.0	2202	1086	1.000	1.000	NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=NNT PE=1 SV=3
7	Q18031	0.0	1224	1041	0.588	0.614	Q18031_CAEEL proton-translocating NAD(P)(+) transhydrogenase OS=Caenorhabditis elegans OX=6239 GN=nnt-1 PE=1 SV=2
8	Q5BJZ3	0.0	2064	1086	0.931	0.931	Q5BJZ3_RAT proton-translocating NAD(P)(+) transhydrogenase OS=Rattus norvegicus OX=10116 GN=Nnt PE=1 SV=1
9	Q61941	0.0	2065	1086	0.931	0.931	NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Nnt PE=1 SV=2
10	W5PFI3	0.0	2144	1086	0.971	0.971	NNTM_SHEEP NAD(P) transhydrogenase, mitochondrial OS=Ovis aries OX=9940 GN=NNT PE=1 SV=2
11	P07001	4.04e-164	496	510	0.248	0.527	PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=pntA PE=1 SV=2
12	P0AB67	1.47e-150	459	462	0.219	0.515	PNTB_ECOLI NAD(P) transhydrogenase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=pntB PE=1 SV=1
13	Q9ALA2	4.42e-146	449	523	0.232	0.482	PNTA_CERSP NAD(P) transhydrogenase subunit alpha OS=Cereibacter sphaeroides OX=1063 GN=pntA PE=1 SV=1
14	Q2RSB4	5.12e-116	368	464	0.193	0.453	PNTB_RHORT NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=pntB PE=1 SV=1
15	Q72GS0	3.53e-85	285	450	0.152	0.367	Q72GS0_THET2 NAD(P) transhydrogenase subunit beta OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=TT_C1778 PE=1 SV=1
16	Q2RSB2	2.62e-83	278	384	0.145	0.409	PNTAA_RHORT NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=pntAA PE=1 SV=1
17	Q72GR8	2.08e-75	255	375	0.144	0.416	Q72GR8_THET2 NAD/NADP transhydrogenase alpha subunit 1 OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=TT_C1780 PE=1 SV=1
18	P96832	7.94e-73	248	366	0.140	0.415	P96832_MYCTU Probable NAD(P) transhydrogenase (Subunit alpha) PntAa [first part catalytic part] (Pyridine nucleotide transhydrogenase subunit alpha) (Nicotinamide nucleotide transhydrogenase subunit alpha) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pntAa PE=1 SV=1
19	P96834	4.34e-72	249	475	0.164	0.375	P96834_MYCTU NAD(P) transhydrogenase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pntB PE=1 SV=1
20	Q08352	1.28e-35	142	378	0.101	0.291	DHA_BACSU Alanine dehydrogenase OS=Bacillus subtilis (strain 168) OX=224308 GN=ald PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	41	14.9	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF01262 AlaDh_PNT_C	3.8e-65	230.8	Alanine dehydrogenase/PNT, C-terminal domain
3	PF05222 AlaDh_PNT_N	1e-40	150.6	Alanine dehydrogenase/PNT, N-terminal domain
4	PF02233 PNTB	6.1e-181	614.0	NAD(P) transhydrogenase beta subunit
5	PF12769 PNTB_4TM	7.9e-27	104.9	4TM region of pyridine nucleotide transhydrogenase, mitoch
6	PF07992 Pyr_redox_2	1.7e+02	12.9	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000202967	0.967	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
2	9606.ENSP00000340523	0.946	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
3	9606.ENSP00000367890	0.945	NAD kinase
4	9606.ENSP00000329466	0.943	NAD-dependent protein deacetylase sirtuin-7
5	9606.ENSP00000371362	0.943	NAD kinase 2, mitochondrial
6	9606.ENSP00000372191	0.934	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
7	9606.ENSP00000287713	0.929	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
8	9606.ENSP00000212015	0.928	NAD-dependent protein deacetylase sirtuin-1
9	9606.ENSP00000326424	0.927	Glutamine-dependent NAD(+) synthetase
10	9606.ENSP00000366410	0.927	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
11	9606.ENSP00000476228	0.927	NAD-dependent protein deacylase sirtuin-5, mitochondrial
12	9606.ENSP00000249396	0.925	NAD-dependent protein deacetylase sirtuin-2
13	9606.ENSP00000337332	0.925	NAD-dependent protein deacetylase sirtuin-6
14	9606.ENSP00000226279	0.902	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
15	9606.ENSP00000230792	0.902	Peroxisomal NADH pyrophosphatase NUDT12
16	9606.ENSP00000265016	0.901	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
17	9606.ENSP00000354238	0.900	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
18	9606.ENSP00000406261	0.900	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
19	9606.ENSP00000331897	0.832	Isocitrate dehydrogenase [NADP], mitochondrial
20	9606.ENSP00000370223	0.768	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016651	0.998	oxidoreductase activity, acting on NAD(P)H
GO:0030554	0.998	adenyl nucleotide binding
GO:0005215	0.996	transporter activity
GO:0022890	0.993	inorganic cation transmembrane transporter activity
GO:0050661	0.992	NADP binding
GO:0008324	0.985	monoatomic cation transmembrane transporter activity
GO:0051287	0.977	NAD binding
GO:0008746	0.967	NAD(P)+ transhydrogenase activity
GO:0015078	0.914	proton transmembrane transporter activity
GO:0042802	0.864	identical protein binding
GO:0003957	0.494	NAD(P)+ transhydrogenase (B-specific) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0098869	0.992	cellular oxidant detoxification
GO:0009117	0.986	nucleotide metabolic process
GO:0051881	0.982	regulation of mitochondrial membrane potential
GO:2000377	0.982	regulation of reactive oxygen species metabolic process
GO:0048522	0.979	positive regulation of cellular process
GO:0006739	0.977	NADP metabolic process
GO:0006740	0.974	NADPH regeneration
GO:0055082	0.969	intracellular chemical homeostasis
GO:0010310	0.969	regulation of hydrogen peroxide metabolic process
GO:2000379	0.969	positive regulation of reactive oxygen species metabolic process
GO:0031331	0.960	positive regulation of cellular catabolic process
GO:0051248	0.958	negative regulation of protein metabolic process
GO:0048523	0.957	negative regulation of cellular process
GO:0001933	0.945	negative regulation of protein phosphorylation
GO:0007584	0.938	response to nutrient
GO:0033273	0.929	response to vitamin
GO:0045454	0.910	cell redox homeostasis
GO:0043066	0.905	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.968	membrane
GO:0031090	0.799	organelle membrane
GO:0070013	0.788	intracellular organelle lumen
GO:0031966	0.400	mitochondrial membrane
GO:0019866	0.365	organelle inner membrane
GO:0005743	0.360	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.6.-.-	0.998	Acting on NADH or NADPH.
RHEA:11692	0.967	NAD(+) + NADPH = NADH + NADP(+)
EC:1.6.1.1	0.967	NAD(P)(+) transhydrogenase (Si-specific).

[back to server]