StarFunc result for job id Q13426

User Input

>input (336 residues)
MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMA
MEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPA
EVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRF
ILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQ
TDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKENSR
PDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAQ8	0.659	0.659	5.738E-49	336	1.000	1.000	A0A024RAQ8.pdb.gz
2	AFDB:Q924T3	0.629	0.648	1.721E-35	326	0.732	0.755	Q924T3.pdb.gz	XRCC4_MOUSE DNA repair protein XRCC4 OS=Mus musculus OX=10090 GN=Xrcc4 PE=1 SV=1
3	AFDB:Q5XI44	0.609	0.632	2.273E-34	323	0.699	0.728	Q5XI44.pdb.gz
4	PDB:7lt3F	0.520	0.805	6.748E-31	213	0.604	0.953	7lt3F.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
5	AFDB:Q682V0	0.525	0.651	9.461E-12	264	0.146	0.186	Q682V0.pdb.gz	XRCC4_ARATH DNA repair protein XRCC4 OS=Arabidopsis thaliana OX=3702 GN=XRCC4 PE=1 SV=2
6	AFDB:Q68UI8	0.291	0.172	3.598E-6	603	0.193	0.108	Q68UI8.pdb.gz	CCD61_CHLRE Variable flagella 3 OS=Chlamydomonas reinhardtii OX=3055 GN=VFL3 PE=1 SV=1
7	PDB:7lsyH	0.276	0.390	3.048E-4	223	0.068	0.103	7lsyH.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
8	PDB:3wtfB	0.283	0.599	5.729E-4	134	0.062	0.157	3wtfB.pdb.gz
9	AFDB:A8WHR3	0.108	0.106	1.560E-2	345	0.110	0.107	A8WHR3.pdb.gz	YJU2_DANRE Splicing factor YJU2 OS=Danio rerio OX=7955 GN=yju2 PE=1 SV=1
10	PDB:8dfvK	0.095	0.118	2.126E-2	253	0.045	0.059	8dfvK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
11	AFDB:A8MR03	0.101	0.100	4.380E-2	338	0.128	0.127	A8MR03.pdb.gz	A8MR03_ARATH Splicing factor YJU2 OS=Arabidopsis thaliana OX=3702 GN=CWC16B PE=1 SV=1
12	AFDB:Q6QI24	0.140	0.081	6.930E-2	596	0.116	0.065	Q6QI24.pdb.gz	Q6QI24_RAT LRRGT00184 OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=2 SV=1
13	AFDB:Q95PZ0	0.150	0.120	7.772E-2	426	0.155	0.122	Q95PZ0.pdb.gz	CSN6_CAEEL COP9 signalosome complex subunit 6 OS=Caenorhabditis elegans OX=6239 GN=csn-6 PE=1 SV=1
14	AFDB:Q9BW85	0.124	0.133	8.717E-2	323	0.104	0.108	Q9BW85.pdb.gz	YJU2_HUMAN Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1
15	PDB:2gjeD	0.145	0.276	1.059E-1	147	0.057	0.129	2gjeD.pdb.gz	Crystal Structures of T. brucei MRP1/MRP2 Guide-RNA Binding Complex Reveal RNA Matchmaking Mechanism.
16	PDB:1iznA	0.106	0.125	1.258E-1	275	0.042	0.051	1iznA.pdb.gz
17	PDB:7zpkC	0.096	0.130	1.332E-1	233	0.065	0.094	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
18	PDB:3saoA	0.084	0.162	1.411E-1	150	0.033	0.073	3saoA.pdb.gz	Galline Ex-FABP Is an Antibacterial Siderocalin and a Lysophosphatidic Acid Sensor Functioning through Dual Ligand Specificities.
19	PDB:3cm1A	0.142	0.288	1.880E-1	137	0.018	0.044	3cm1A.pdb.gz
20	PDB:7enaq	0.094	0.061	1.880E-1	555	0.062	0.038	7enaq.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13426	0.0	693	336	1.000	1.000	XRCC4_HUMAN DNA repair protein XRCC4 OS=Homo sapiens OX=9606 GN=XRCC4 PE=1 SV=2
2	Q924T3	1.70e-170	478	326	0.738	0.761	XRCC4_MOUSE DNA repair protein XRCC4 OS=Mus musculus OX=10090 GN=Xrcc4 PE=1 SV=1
3	F7EEB9	7.44e-158	447	338	0.699	0.695	F7EEB9_RAT X-ray repair cross complementing 4 OS=Rattus norvegicus OX=10116 GN=Xrcc4 PE=1 SV=1
4	A0A8I5Y5Z6	1.80e-157	446	342	0.699	0.687	A0A8I5Y5Z6_RAT X-ray repair cross complementing 4 OS=Rattus norvegicus OX=10116 GN=Xrcc4 PE=1 SV=1
5	Q682V0	3.88e-07	52.8	264	0.146	0.186	XRCC4_ARATH DNA repair protein XRCC4 OS=Arabidopsis thaliana OX=3702 GN=XRCC4 PE=1 SV=2
6	O13890	0.054	37.7	568	0.083	0.049	SELO_SCHPO Protein adenylyltransferase SelO, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC20G4.05c PE=3 SV=1
7	O94296	1.5	33.5	1258	0.077	0.021	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
8	Q86UP2	3.8	32.0	1357	0.051	0.013	KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1
9	Q61595	4.0	32.0	1327	0.051	0.013	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
10	Q02224	4.6	32.0	2701	0.083	0.010	CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2
11	U4PCM1	5.1	31.6	809	0.036	0.015	WDR33_CAEEL pre-mRNA 3' end processing protein pfs-2 OS=Caenorhabditis elegans OX=6239 GN=pfs-2 PE=1 SV=2
12	Q96M69	7.8	30.8	825	0.068	0.028	LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens OX=9606 GN=LRGUK PE=1 SV=1
13	Q586J3	9.9	30.8	978	0.077	0.027	Q586J3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.220 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12729 4HB_MCP_1	6.9e+02	11.1	Four helix bundle sensory module for signal transduction
2	PF09302 XLF	20	16.5	XLF-Cernunnos, XRcc4-like factor, NHEJ component
3	PF06632 XRCC4	9.2e-143	486.8	DNA double-strand break repair and V(D)J recombination protein XRCC4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421491

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307004	0.999	Aprataxin and PNK-like factor
2	9606.ENSP00000313420	0.999	DNA-dependent protein kinase catalytic subunit
3	9606.ENSP00000323511	0.999	Bifunctional polynucleotide phosphatase/kinase
4	9606.ENSP00000349313	0.999	Non-homologous end-joining factor 1
5	9606.ENSP00000352257	0.999	X-ray repair cross-complementing protein 6
6	9606.ENSP00000400806	0.999	Aprataxin
7	9606.ENSP00000484288	0.999	DNA ligase 4
8	9606.ENSP00000375978	0.998	X-ray repair cross-complementing protein 5
9	9606.ENSP00000360682	0.994	Protein PAXX
10	9606.ENSP00000262887	0.988	DNA repair protein XRCC1
11	9606.ENSP00000379174	0.986	DNA-directed DNA/RNA polymerase mu
12	9606.ENSP00000278616	0.979	Serine-protein kinase ATM
13	9606.ENSP00000359181	0.975	DNA polymerase lambda
14	9606.ENSP00000367527	0.972	Protein artemis
15	9606.ENSP00000013807	0.965	DNA excision repair protein ERCC-1
16	9606.ENSP00000265433	0.965	Nibrin
17	9606.ENSP00000234420	0.961	DNA mismatch repair protein Msh6
18	9606.ENSP00000233146	0.959	DNA mismatch repair protein Msh2
19	9606.ENSP00000360216	0.956	DNA nucleotidylexotransferase
20	9606.ENSP00000325863	0.954	Double-strand break repair protein MRE11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0060090	0.997	molecular adaptor activity
GO:0003676	0.996	nucleic acid binding
GO:0003824	0.993	catalytic activity
GO:0019904	0.986	protein domain specific binding
GO:0042802	0.982	identical protein binding
GO:0140097	0.956	catalytic activity, acting on DNA
GO:0016787	0.885	hydrolase activity
GO:0004518	0.879	nuclease activity
GO:0004536	0.835	deoxyribonuclease activity
GO:0004520	0.825	DNA endonuclease activity
GO:0000014	0.795	single-stranded DNA endodeoxyribonuclease activity
GO:0070975	0.592	FHA domain binding
GO:0003677	0.487	DNA binding
GO:1990599	0.346	3' overhang single-stranded DNA endodeoxyribonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006974	0.995	cellular response to DNA damage stimulus
GO:0006259	0.995	DNA metabolic process
GO:0006302	0.990	double-strand break repair
GO:0065007	0.985	biological regulation
GO:0009314	0.962	response to radiation
GO:0050794	0.959	regulation of cellular process
GO:0006303	0.958	double-strand break repair via nonhomologous end joining
GO:0010212	0.922	response to ionizing radiation
GO:0071840	0.687	cellular component organization or biogenesis
GO:0048518	0.660	positive regulation of biological process
GO:0016043	0.655	cellular component organization
GO:0048522	0.639	positive regulation of cellular process
GO:0019222	0.606	regulation of metabolic process
GO:0051179	0.605	localization
GO:0033036	0.576	macromolecule localization
GO:0080090	0.569	regulation of primary metabolic process
GO:0051171	0.567	regulation of nitrogen compound metabolic process
GO:0031323	0.558	regulation of cellular metabolic process
GO:0060255	0.550	regulation of macromolecule metabolic process
GO:0051128	0.466	regulation of cellular component organization
GO:0048519	0.463	negative regulation of biological process
GO:0048523	0.438	negative regulation of cellular process
GO:0019219	0.422	regulation of nucleobase-containing compound metabolic process
GO:0006310	0.405	DNA recombination
GO:0051052	0.373	regulation of DNA metabolic process
GO:0006996	0.354	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.962	protein-containing complex
GO:0043232	0.957	intracellular non-membrane-bounded organelle
GO:0140513	0.827	nuclear protein-containing complex
GO:0005694	0.819	chromosome
GO:1902494	0.791	catalytic complex
GO:0005737	0.623	cytoplasm
GO:0140535	0.622	intracellular protein-containing complex
GO:1990391	0.618	DNA repair complex
GO:0005829	0.430	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.885	Hydrolases.
EC:3.1.-.-	0.879	Acting on ester bonds.

[back to server]