StarFunc result for job id Q13428

User Input

>input (1488 residues)
MAEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELG
RKRKAEEDAALQAKKTRVSDPISTSESSEEEEEAEAETAKATPRLASTNSSVLGADLPSS
MKEKAKAETEKAGKTGNSMPHPATGKTVANLLSGKSPRKSAEPSANTTLVSETEEEGSVP
AFGAAAKPGMVSAGQADSSSEDTSSSSDETDVEGKPSVKPAQVKASSVSTKESPARKAAP
APGKVGDVTPQVKGGALPPAKRAKKPEEESESSEEGSESEEEAPAGTRSQVKASEKILQV
RAASAPAKGTPGKGATPAPPGKAGAVASQTKAGKPEEDSESSSEESSDSEEETPAAKALL
QAKASGKTSQVGAASAPAKESPRKGAAPAPPGKTGPAVAKAQAGKREEDSQSSSEESDSE
EEAPAQAKPSGKAPQVRAASAPAKESPRKGAAPAPPRKTGPAAAQVQVGKQEEDSRSSSE
ESDSDREALAAMNAAQVKPLGKSPQVKPASTMGMGPLGKGAGPVPPGKVGPATPSAQVGK
WEEDSESSSEESSDSSDGEVPTAVAPAQEKSLGNILQAKPTSSPAKGPPQKAGPVAVQVK
AEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTASAKVAPVR
VGTQAPRKAGTATSPAGSSPAVAGGTQRPAEDSSSSEESDSEEEKTGLAVTVGQAKSVGK
GLQVKAASVPVKGSLGQGTAPVLPGKTGPTVTQVKAEKQEDSESSEEESDSEEAAASPAQ
VKTSVKKTQAKANPAAARAPSAKGTISAPGKVVTAAAQAKQRSPSKVKPPVRNPQNSTVL
ARGPASVPSVGKAVATAAQAQTGPEEDSGSSEEESDSEEEAETLAQVKPSGKTHQIRAAL
APAKESPRKGAAPTPPGKTGPSAAQAGKQDDSGSSSEESDSDGEAPAAVTSAQVIKPPLI
FVDPNRSPAGPAATPAQAQAASTPRKARASESTARSSSSESEDEDVIPATQCLTPGIRTN
VVTMPTAHPRIAPKASMAGASSSKESSRISDGKKQEGPATQVSKKNPASLPLTQAALKVL
AQKASEAQPPVARTQPSSGVDSAVGTLPATSPQSTSVQAKGTNKLRKPKLPEVQQATKAP
ESSDDSEDSSDSSSGSEEDGEGPQGAKSAHTLGPTPSRTETLVEETAAESSEDDVVAPSQ
SLLSGYMTPGLTPANSQASKATPKLDSSPSVSSTLAAKDDPDGKQEAKPQQAAGMLSPKT
GGKEAASGTTPQKSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLT
ELLEQERKKVVDTTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPE
KTSTTSKGKAKRDKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKK
EKKKSDKRKKDKEKKEKKKKAKKASTKDSESPSQKKKKKKKKTAEQTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13428	0.999	0.999	0.000	1488	1.000	1.000	Q13428.pdb.gz	TCOF_HUMAN Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3
2	AFDB:O08784	0.103	0.112	5.740E-71	1320	0.524	0.591	O08784.pdb.gz	TCOF_MOUSE Treacle protein OS=Mus musculus OX=10090 GN=Tcof1 PE=1 SV=1
3	AFDB:Q9UPQ9	0.046	0.040	3.729E-6	1833	0.164	0.133	Q9UPQ9.pdb.gz	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4
4	AFDB:Q8IL84	0.031	0.025	2.086E-4	2020	0.110	0.081	Q8IL84.pdb.gz	MCA2_PLAF7 Metacaspase-2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=MCA2 PE=1 SV=2
5	AFDB:D3Z8E6	0.033	0.031	3.415E-4	1604	0.116	0.108	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
6	AFDB:Q3UHK8	0.036	0.030	6.588E-4	1896	0.151	0.119	Q3UHK8.pdb.gz	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
7	AFDB:F8W451	0.042	0.053	8.429E-4	1133	0.089	0.117	F8W451.pdb.gz	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
8	AFDB:Q8IHQ2	0.037	0.041	1.078E-3	1301	0.056	0.065	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
9	AFDB:B8JIY2	0.039	0.056	1.380E-3	1001	0.185	0.275	B8JIY2.pdb.gz	B8JIY2_DANRE Nucleolar and coiled-body phosphoprotein 1 OS=Danio rerio OX=7955 GN=fd05f01 PE=1 SV=1
10	AFDB:F1LV37	0.047	0.040	1.380E-3	1818	0.161	0.132	F1LV37.pdb.gz	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
11	PDB:7bouA	0.040	0.092	1.390	525	0.007	0.019	7bouA.pdb.gz
12	PDB:7wtww	0.017	0.075	2.276	332	0.006	0.027	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
13	PDB:5x3xQ	0.033	0.169	3.161	243	0.009	0.058	5x3xQ.pdb.gz
14	PDB:4nq0A	0.027	0.132	3.432	254	0.006	0.035	4nq0A.pdb.gz
15	PDB:5y88V	0.022	0.259	3.726	91	0.004	0.066	5y88V.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
16	PDB:5o9zL	0.022	0.069	4.045	459	0.004	0.013	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
17	PDB:2rvqD	0.028	0.213	4.391	129	0.010	0.116	2rvqD.pdb.gz
18	PDB:7pntL	0.024	0.142	4.391	176	0.011	0.091	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
19	PDB:2fi7A	0.021	0.136	5.175	223	0.003	0.018	2fi7A.pdb.gz
20	PDB:3jd5O	0.026	0.156	5.618	173	0.009	0.075	3jd5O.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IS06	0.0	1574	1358	0.745	0.816	A0A3B3IS06_HUMAN Treacle ribosome biogenesis factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=1
2	A0A6I8PRA0	0.0	2253	1240	0.807	0.969	A0A6I8PRA0_HUMAN Treacle ribosome biogenesis factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=1
3	E7ETY2	0.0	2732	1488	0.974	0.974	E7ETY2_HUMAN Treacle ribosome biogenesis factor 1 OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=1
4	H0Y8Y7	0.0	1806	994	0.640	0.959	H0Y8Y7_HUMAN Treacle ribosome biogenesis factor 1 OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=2
5	Q13428	0.0	2845	1488	1.000	1.000	TCOF_HUMAN Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3
6	O08784	1.78e-126	429	1320	0.355	0.400	TCOF_MOUSE Treacle protein OS=Mus musculus OX=10090 GN=Tcof1 PE=1 SV=1
7	Q61687	3.1	35.0	2476	0.014	0.008	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
8	Q14978	4.4	34.3	699	0.012	0.026	NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06990 Gal-3-0_sulfotr	1.2e+02	13.0	Galactose-3-O-sulfotransferase
2	PF03546 Treacle	4.8e-267	898.8	Treacher Collins syndrome protein Treacle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367028

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401878	0.869	Kelch repeat and BTB domain-containing protein 8
2	9606.ENSP00000302640	0.807	Nucleolar transcription factor 1
3	9606.ENSP00000302478	0.805	DNA-directed RNA polymerases I and III subunit RPAC2
4	9606.ENSP00000385410	0.800	Nucleolar and coiled-body phosphoprotein 1
5	9606.ENSP00000370589	0.793	Nucleolar protein 56
6	9606.ENSP00000265433	0.750	Nibrin
7	9606.ENSP00000409581	0.743	Beta-arrestin-1
8	9606.ENSP00000325929	0.739	Ligand of numb-protein X 2
9	9606.ENSP00000323527	0.734	Muskelin
10	9606.ENSP00000362649	0.732	Histone deacetylase 1
11	9606.ENSP00000344314	0.728	Oral-facial-digital syndrome 1 protein
12	9606.ENSP00000261797	0.722	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
13	9606.ENSP00000262506	0.699	Casein kinase II subunit alpha
14	9606.ENSP00000342626	0.678	Eyes absent homolog 1
15	9606.ENSP00000217964	0.675	F-box-like/WD repeat-containing protein TBL1X
16	9606.ENSP00000332371	0.672	Collagen alpha-1(VII) chain
17	9606.ENSP00000432770	0.671	Eyes absent homolog 4
18	9606.ENSP00000263857	0.667	DNA-directed RNA polymerase I subunit RPA1
19	9606.ENSP00000227520	0.658	Coiled-coil domain containing 86
20	9606.ENSP00000380378	0.650	Platelet-activating factor acetylhydrolase IB subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0097110	1.000	scaffold protein binding
GO:0046982	1.000	protein heterodimerization activity
GO:0003723	1.000	RNA binding
GO:0003824	0.324	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0009889	0.975	regulation of biosynthetic process
GO:0010556	0.974	regulation of macromolecule biosynthetic process
GO:0031326	0.974	regulation of cellular biosynthetic process
GO:0032502	0.970	developmental process
GO:0010468	0.956	regulation of gene expression
GO:0048856	0.896	anatomical structure development
GO:0032501	0.869	multicellular organismal process
GO:0051246	0.841	regulation of protein metabolic process
GO:2000112	0.791	regulation of cellular macromolecule biosynthetic process
GO:0071704	0.740	organic substance metabolic process
GO:0044238	0.735	primary metabolic process
GO:0034248	0.728	regulation of amide metabolic process
GO:0006807	0.721	nitrogen compound metabolic process
GO:0043170	0.685	macromolecule metabolic process
GO:0044237	0.596	cellular metabolic process
GO:0007275	0.475	multicellular organism development
GO:0030154	0.470	cell differentiation
GO:0048513	0.462	animal organ development
GO:0009888	0.446	tissue development
GO:0010608	0.426	post-transcriptional regulation of gene expression
GO:0009653	0.409	anatomical structure morphogenesis
GO:0048468	0.381	cell development
GO:0048731	0.378	system development
GO:0006417	0.356	regulation of translation
GO:0034641	0.354	cellular nitrogen compound metabolic process
GO:0048762	0.346	mesenchymal cell differentiation
GO:0090304	0.310	nucleic acid metabolic process
GO:0010467	0.306	gene expression
GO:0009790	0.300	embryo development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0001650	1.000	fibrillar center
GO:0032991	0.505	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]