StarFunc result for job id Q13432

User Input

>input (240 residues)
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPI
GPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRD
LDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFG
FCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13432	1.000	1.000	7.690E-47	240	1.000	1.000	Q13432.pdb.gz	U119A_HUMAN Protein unc-119 homolog A OS=Homo sapiens OX=9606 GN=UNC119 PE=1 SV=1
2	AFDB:A1L1X3	0.754	0.687	8.593E-34	264	0.671	0.610	A1L1X3.pdb.gz
3	PDB:4gojC	0.642	0.944	6.340E-31	161	0.667	0.994	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
4	AFDB:A6NIH7	0.758	0.726	1.549E-30	251	0.596	0.570	A6NIH7.pdb.gz	U119B_HUMAN Protein unc-119 homolog B OS=Homo sapiens OX=9606 GN=UNC119B PE=1 SV=1
5	AFDB:Q90Z08	0.719	0.711	5.720E-30	243	0.562	0.556	Q90Z08.pdb.gz	U119B_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119b PE=1 SV=2
6	AFDB:G5EGP9	0.702	0.690	3.143E-29	244	0.496	0.488	G5EGP9.pdb.gz	G5EGP9_CAEEL GMP phosphodiesterase delta subunit domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-119 PE=1 SV=1
7	AFDB:Q9XYQ2	0.706	0.642	4.677E-29	265	0.558	0.506	Q9XYQ2.pdb.gz	UN119_DROME Protein unc-119 homolog OS=Drosophila melanogaster OX=7227 GN=unc-119 PE=2 SV=1
8	AFDB:E7F2M1	0.682	0.629	1.495E-27	261	0.471	0.433	E7F2M1.pdb.gz	E7F2M1_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119.2 PE=1 SV=1
9	AFDB:Q586Q9	0.692	0.839	9.116E-23	196	0.342	0.418	Q586Q9.pdb.gz	Q586Q9_TRYB2 GMP phosphodiesterase delta subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.290 PE=3 SV=1
10	PDB:5nalB	0.502	0.779	5.123E-13	150	0.142	0.227	5nalB.pdb.gz	Covalent Protein Labeling at Glutamic Acids.
11	AFDB:O55057	0.519	0.803	8.410E-13	150	0.146	0.233	O55057.pdb.gz	PDE6D_MOUSE Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Mus musculus OX=10090 GN=Pde6d PE=1 SV=1
12	AFDB:F1QZ52	0.524	0.811	2.772E-12	150	0.142	0.227	F1QZ52.pdb.gz
13	PDB:1ksgB	0.379	0.666	1.410E-8	128	0.125	0.234	1ksgB.pdb.gz	The complex of Arl2-GTP and PDE delta: from structure to function.
14	PDB:4f38B	0.415	0.501	3.802E-7	192	0.075	0.094	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
15	PDB:5kwyC	0.259	0.418	4.874E-4	133	0.029	0.053	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
16	PDB:5f0jB	0.293	0.242	1.142E-3	306	0.062	0.049	5f0jB.pdb.gz
17	PDB:2hkaB	0.213	0.343	1.209E-3	130	0.050	0.092	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
18	PDB:1l9mB	0.278	0.110	2.016E-3	681	0.037	0.013	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
19	PDB:6o22D	0.232	0.312	2.391E-3	164	0.067	0.098	6o22D.pdb.gz
20	PDB:3t6qC	0.251	0.388	5.294E-3	139	0.033	0.058	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13432	4.80e-179	492	240	1.000	1.000	U119A_HUMAN Protein unc-119 homolog A OS=Homo sapiens OX=9606 GN=UNC119 PE=1 SV=1
2	Q62885	2.26e-157	437	240	0.921	0.921	U119A_RAT Protein unc-119 homolog A OS=Rattus norvegicus OX=10116 GN=Unc119 PE=1 SV=1
3	Q9Z2R6	7.22e-157	436	240	0.917	0.917	U119A_MOUSE Protein unc-119 homolog A OS=Mus musculus OX=10090 GN=Unc119 PE=1 SV=1
4	Q1RM42	4.41e-112	324	264	0.667	0.606	Q1RM42_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119.2 PE=2 SV=1
5	Q90Z08	6.83e-93	275	243	0.537	0.531	U119B_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119b PE=1 SV=2
6	A6NIH7	1.98e-92	273	251	0.542	0.518	U119B_HUMAN Protein unc-119 homolog B OS=Homo sapiens OX=9606 GN=UNC119B PE=1 SV=1
7	Q9XYQ2	1.20e-84	254	265	0.500	0.453	UN119_DROME Protein unc-119 homolog OS=Drosophila melanogaster OX=7227 GN=unc-119 PE=2 SV=1
8	G5EGP9	4.27e-77	234	244	0.496	0.488	G5EGP9_CAEEL GMP phosphodiesterase delta subunit domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-119 PE=1 SV=1
9	Q10658	1.57e-76	232	219	0.475	0.521	UN119_CAEEL Protein unc-119 OS=Caenorhabditis elegans OX=6239 GN=unc-119 PE=1 SV=1
10	C0P283	1.10e-75	229	199	0.458	0.553	C0P283_CAEEL GMP phosphodiesterase delta subunit domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-119 PE=1 SV=1
11	E7F2M1	9.68e-71	219	261	0.442	0.406	E7F2M1_DANRE Protein unc-119 homolog B OS=Danio rerio OX=7955 GN=unc119.2 PE=1 SV=1
12	Q586Q9	1.59e-48	160	196	0.354	0.434	Q586Q9_TRYB2 GMP phosphodiesterase delta subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.290 PE=3 SV=1
13	O55057	1.08e-05	46.2	150	0.113	0.180	PDE6D_MOUSE Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Mus musculus OX=10090 GN=Pde6d PE=1 SV=1
14	Q95142	2.58e-05	45.4	150	0.108	0.173	PDE6D_BOVIN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Bos taurus OX=9913 GN=PDE6D PE=1 SV=1
15	O43924	5.44e-05	44.3	150	0.108	0.173	PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Homo sapiens OX=9606 GN=PDE6D PE=1 SV=1
16	Q18268	6.64e-05	44.3	159	0.087	0.132	PDL1_CAEEL Phosphodiesterase delta-like protein OS=Caenorhabditis elegans OX=6239 GN=pdl-1 PE=1 SV=1
17	Q6DH83	4.73e-04	41.6	150	0.083	0.133	Q6DH83_DANRE Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Danio rerio OX=7955 GN=zgc:92605 PE=1 SV=1
18	Q9VLJ0	0.080	35.0	151	0.121	0.192	PDE6D_DROME Probable cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Drosophila melanogaster OX=7227 GN=PrBP PE=1 SV=1
19	Q9LKF9	0.085	36.2	739	0.163	0.053	CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CPSF100 PE=1 SV=2
20	Q8IEU9	3.3	31.6	3346	0.079	0.006	Q8IEU9_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1300300 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05351 GMP_PDE_delta	1.5e-70	247.7	GMP-PDE, delta subunit
2	PF05049 IIGP	3.5e+02	11.6	Interferon-inducible GTPase (IIGP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337040

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260746	0.999	ADP-ribosylation factor-like protein 3
2	9606.ENSP00000246747	0.996	ADP-ribosylation factor-like protein 2
3	9606.ENSP00000338766	0.940	Nephrocystin-3
4	9606.ENSP00000361918	0.838	Peptidyl-prolyl cis-trans isomerase E
5	9606.ENSP00000284245	0.816	Uncharacterized protein C16orf74
6	9606.ENSP00000337825	0.784	Tyrosine-protein kinase Lck
7	9606.ENSP00000324527	0.769	Unconventional myosin-Id
8	9606.ENSP00000324960	0.748	Calcium-binding protein 4
9	9606.ENSP00000332773	0.748	Immunoglobulin superfamily DCC subclass member 3
10	9606.ENSP00000264852	0.747	SID1 transmembrane family member 1
11	9606.ENSP00000278919	0.740	Fasciculation and elongation protein zeta-1
12	9606.ENSP00000324842	0.740	Acetoacetyl-CoA synthetase
13	9606.ENSP00000326110	0.737	UNC119-binding protein C5orf30
14	9606.ENSP00000367756	0.709	Protein unc-13 homolog B
15	9606.ENSP00000262483	0.706	Membrane-associated phosphatidylinositol transfer protein 3
16	9606.ENSP00000398632	0.704	CD44 antigen
17	9606.ENSP00000311825	0.703	C-terminal-binding protein 2
18	9606.ENSP00000287600	0.702	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
19	9606.ENSP00000256339	0.700	Protein unc-79 homolog
20	9606.ENSP00000442478	0.697	Stomatin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008289	0.990	lipid binding
GO:0003824	0.301	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0006810	0.956	transport
GO:0033036	0.950	macromolecule localization
GO:0032501	0.944	multicellular organismal process
GO:0051641	0.860	cellular localization
GO:0008104	0.821	protein localization
GO:0071702	0.790	organic substance transport
GO:0050896	0.745	response to stimulus
GO:0048519	0.666	negative regulation of biological process
GO:0071705	0.646	nitrogen compound transport
GO:0019222	0.511	regulation of metabolic process
GO:0048518	0.505	positive regulation of biological process
GO:0007154	0.491	cell communication
GO:0023052	0.486	signaling
GO:0031323	0.479	regulation of cellular metabolic process
GO:0048523	0.473	negative regulation of cellular process
GO:0048522	0.466	positive regulation of cellular process
GO:0051716	0.464	cellular response to stimulus
GO:0071840	0.448	cellular component organization or biogenesis
GO:0007165	0.447	signal transduction
GO:0060255	0.423	regulation of macromolecule metabolic process
GO:0050877	0.421	nervous system process
GO:0080090	0.420	regulation of primary metabolic process
GO:0016043	0.418	cellular component organization
GO:0051171	0.417	regulation of nitrogen compound metabolic process
GO:0015031	0.407	protein transport
GO:0050953	0.387	sensory perception of light stimulus
GO:0007601	0.378	visual perception
GO:0051128	0.348	regulation of cellular component organization
GO:0065009	0.322	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0043229	0.993	intracellular organelle
GO:0005829	0.993	cytosol
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0043227	0.935	membrane-bounded organelle
GO:0005856	0.934	cytoskeleton
GO:0015630	0.862	microtubule cytoskeleton
GO:0043231	0.789	intracellular membrane-bounded organelle
GO:0005815	0.782	microtubule organizing center
GO:0045171	0.767	intercellular bridge
GO:0000922	0.761	spindle pole
GO:0005813	0.753	centrosome
GO:0120025	0.541	plasma membrane bounded cell projection
GO:0016020	0.524	membrane
GO:0005929	0.409	cilium
GO:0005654	0.330	nucleoplasm
GO:0051233	0.323	spindle midzone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]