StarFunc result for job id Q13438

User Input

>input (667 residues)
MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDV
VIVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTY
EFCYGRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSK
CDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAA
PQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGAS
PTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIR
SPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDED
EDEDEDEDERQLLGEFEKELEGILLPSDRDRLRSEVKAGMERELENIIQETEKELDPDGL
KKESERDRAMLALTSTLNKLIKRLEEKQSPELVKKHKKKRVVPKKPPPSPQPTEEDPEHR
VRVRVTKLRLGGPNQDLTVLEMKRENPQLKQIEGLVKELLEREGLTAAGKIEIKIVRPWA
EGTEEGARWLTDEDTRNLKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTG
DLDEFDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13438	1.000	1.000	0.000	667	1.000	1.000	Q13438.pdb.gz	OS9_HUMAN Protein OS-9 OS=Homo sapiens OX=9606 GN=OS9 PE=1 SV=1
2	AFDB:Q8K2C7	0.639	0.635	6.420E-92	672	0.810	0.804	Q8K2C7.pdb.gz	OS9_MOUSE Protein OS-9 OS=Mus musculus OX=10090 GN=Os9 PE=1 SV=2
3	AFDB:Q91VW5	0.055	0.020	1.415E-2	2238	0.111	0.033	Q91VW5.pdb.gz	GOGA4_MOUSE Golgin subfamily A member 4 OS=Mus musculus OX=10090 GN=Golga4 PE=1 SV=2
4	AFDB:Q9Y114	0.063	0.064	1.991E-2	656	0.066	0.067	Q9Y114.pdb.gz	Q9Y114_DROME BcDNA.GH10229 OS=Drosophila melanogaster OX=7227 GN=anon-WO0172774.24 PE=1 SV=1
5	AFDB:O77361	0.052	0.030	5.873E-2	1294	0.085	0.044	O77361.pdb.gz	O77361_PLAF7 TVN-junction protein 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0310400 PE=4 SV=1
6	AFDB:Q6ZW49	0.056	0.042	7.376E-2	1069	0.072	0.045	Q6ZW49.pdb.gz	PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1 PE=1 SV=2
7	AFDB:A3KDM2	0.048	0.047	1.231E-1	681	0.078	0.076	A3KDM2.pdb.gz	A3KDM2_DANRE RNA polymerase-associated protein RTF1 homolog OS=Danio rerio OX=7955 GN=wu:fa04h07 PE=1 SV=1
8	PDB:5jozA	0.065	0.082	1.404E-1	507	0.012	0.016	5jozA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
9	AFDB:Q9W261	0.054	0.048	1.461E-1	775	0.097	0.084	Q9W261.pdb.gz	RTF1_DROME RNA polymerase-associated protein Rtf1 OS=Drosophila melanogaster OX=7227 GN=Rtf1 PE=1 SV=1
10	AFDB:Q9W409	0.066	0.077	1.637E-1	562	0.075	0.089	Q9W409.pdb.gz	Q9W409_DROME LD26135p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG12219 PE=2 SV=1
11	PDB:1ui0A	0.062	0.167	1.763E-1	192	0.018	0.062	1ui0A.pdb.gz	Crystal Structure of a Family 4 Uracil-DNA Glycosylase from Thermus thermophilus HB8
12	AFDB:G9CGD6	0.072	0.056	1.834E-1	899	0.097	0.072	G9CGD6.pdb.gz	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
13	PDB:1cofA	0.057	0.180	2.091E-1	135	0.015	0.074	1cofA.pdb.gz
14	PDB:2oy5O	0.052	0.105	2.626E-1	250	0.015	0.040	2oy5O.pdb.gz
15	PDB:7mq8NW	0.065	0.119	3.491E-1	311	0.019	0.042	7mq8NW.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6lqsB1	0.060	0.051	4.641E-1	806	0.021	0.017	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
17	PDB:7ajtUA	0.066	0.055	4.641E-1	834	0.021	0.017	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:4dapA	0.040	0.101	5.201E-1	232	0.015	0.043	4dapA.pdb.gz
19	PDB:3rfhA	0.065	0.124	6.170E-1	291	0.025	0.058	3rfhA.pdb.gz
20	PDB:5nmtB	0.062	0.063	6.170E-1	657	0.039	0.040	5nmtB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13438	0.0	1353	667	1.000	1.000	OS9_HUMAN Protein OS-9 OS=Homo sapiens OX=9606 GN=OS9 PE=1 SV=1
2	Q5RKH6	0.0	1020	666	0.829	0.830	OS9_RAT Protein OS-9 OS=Rattus norvegicus OX=10116 GN=Os9 PE=1 SV=1
3	Q8K2C7	0.0	972	672	0.813	0.807	OS9_MOUSE Protein OS-9 OS=Mus musculus OX=10090 GN=Os9 PE=1 SV=2
4	Q8GWH3	4.12e-30	122	282	0.121	0.287	OS9_ARATH Protein OS-9 homolog OS=Arabidopsis thaliana OX=3702 GN=OS9 PE=1 SV=1
5	Q96DZ1	1.42e-18	91.7	483	0.094	0.130	ERLEC_HUMAN Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1 PE=1 SV=1
6	Q9VKC7	3.12e-15	81.3	525	0.069	0.088	Q9VKC7_DROME FI04402p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6766 PE=1 SV=1
7	Q8MQY6	4.04e-11	67.8	418	0.076	0.122	Q8MQY6_DROME RE67845p OS=Drosophila melanogaster OX=7227 GN=CG6766 PE=2 SV=1
8	Q383K9	1.10e-06	52.8	262	0.084	0.214	Q383K9_TRYB2 MRH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2470 PE=4 SV=1
9	Q99220	8.36e-06	51.2	542	0.061	0.076	OS9_YEAST Protein OS-9 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOS9 PE=1 SV=1
10	Q9UJJ9	0.012	40.8	305	0.055	0.121	GNPTG_HUMAN N-acetylglucosamine-1-phosphotransferase subunit gamma OS=Homo sapiens OX=9606 GN=GNPTG PE=1 SV=1
11	Q9FM96	0.032	40.0	647	0.033	0.034	PSL4_ARATH Glucosidase 2 subunit beta OS=Arabidopsis thaliana OX=3702 GN=PSL4 PE=2 SV=1
12	Q8IDX6	2.5	33.9	3130	0.063	0.013	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
13	Q7TQ20	5.1	32.7	621	0.046	0.050	DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus OX=10116 GN=Dnajc2 PE=1 SV=1
14	Q6NKR8	6.1	32.3	505	0.039	0.051	Q6NKR8_ARATH At3g14170 OS=Arabidopsis thaliana OX=3702 GN=CORD1 PE=1 SV=1
15	P91280	9.3	32.0	647	0.070	0.073	P91280_CAEEL Small-subunit processome OS=Caenorhabditis elegans OX=6239 GN=CELE_F27C1.6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07915 PRKCSH	3.6e-12	58.4	Glucosidase II beta subunit-like protein
2	PF13015 PRKCSH_1	1.2	20.3	Glucosidase II beta subunit-like protein
3	PF00835 SNAP-25	4.4e+02	12.5	SNAP-25 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337053	0.999	Protein sel-1 homolog 1
2	9606.ENSP00000366395	0.999	E3 ubiquitin-protein ligase synoviolin
3	9606.ENSP00000158771	0.997	Derlin-2
4	9606.ENSP00000351777	0.994	Transitional endoplasmic reticulum ATPase
5	9606.ENSP00000299767	0.993	Endoplasmin
6	9606.ENSP00000437955	0.984	Hypoxia-inducible factor 1-alpha
7	9606.ENSP00000324173	0.975	78 kDa glucose-regulated protein
8	9606.ENSP00000355601	0.968	Egl nine homolog 1
9	9606.ENSP00000185150	0.967	Endoplasmic reticulum lectin 1
10	9606.ENSP00000384744	0.958	Derlin-3
11	9606.ENSP00000250457	0.954	Egl nine homolog 3
12	9606.ENSP00000416066	0.952	Alpha-1-antitrypsin
13	9606.ENSP00000290649	0.950	E3 ubiquitin-protein ligase AMFR
14	9606.ENSP00000259512	0.949	Derlin-1
15	9606.ENSP00000256497	0.944	ER degradation-enhancing alpha-mannosidase-like protein 1
16	9606.ENSP00000327801	0.941	Protein disulfide-isomerase
17	9606.ENSP00000261942	0.935	FAS-associated factor 2
18	9606.ENSP00000318147	0.931	ER degradation-enhancing alpha-mannosidase-like protein 3
19	9606.ENSP00000469686	0.929	Egl nine homolog 2
20	9606.ENSP00000366748	0.918	AUP1, lipid droplet regulating VLDL assembly factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0036503	0.983	ERAD pathway
GO:0050789	0.977	regulation of biological process
GO:0019941	0.975	modification-dependent protein catabolic process
GO:0050794	0.971	regulation of cellular process
GO:0030433	0.968	ubiquitin-dependent ERAD pathway
GO:0036211	0.960	protein modification process
GO:0051179	0.953	localization
GO:0048523	0.943	negative regulation of cellular process
GO:0008104	0.941	protein localization
GO:0070647	0.828	protein modification by small protein conjugation or removal
GO:0033365	0.814	protein localization to organelle
GO:0051224	0.790	negative regulation of protein transport
GO:0032386	0.748	regulation of intracellular transport
GO:0070972	0.748	protein localization to endoplasmic reticulum
GO:0051235	0.737	maintenance of location
GO:0032387	0.737	negative regulation of intracellular transport
GO:0045185	0.717	maintenance of protein location
GO:0033157	0.651	regulation of intracellular protein transport
GO:0072595	0.647	maintenance of protein localization in organelle
GO:0032446	0.600	protein modification by small protein conjugation
GO:0090317	0.541	negative regulation of intracellular protein transport
GO:0051234	0.426	establishment of localization
GO:0016567	0.342	protein ubiquitination
GO:0006810	0.336	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005788	0.999	endoplasmic reticulum lumen
GO:0016020	0.989	membrane
GO:0005789	0.953	endoplasmic reticulum membrane
GO:0031981	0.420	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]