StarFunc result for job id Q13443

User Input

>input (819 residues)
MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPR
PYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYV
EGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNK
DIEKETAKDEEEEPPSMTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMI
LLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDS
AQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDG
RDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSEC
DVPEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCF
IEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKC
WGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNK
NCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLLVFFFLIVPLIVCAIFIFIKR
DQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYANRFAVPTYAA
KQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PTA4	0.776	0.753	0.000	845	0.834	0.808	E9PTA4.pdb.gz	E9PTA4_RAT ADAM metallopeptidase domain 9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=1 SV=2
2	AFDB:Q13443	1.000	1.000	0.000	819	1.000	1.000	Q13443.pdb.gz	ADAM9_HUMAN Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1
3	AFDB:O43184	0.602	0.554	4.570E-82	909	0.371	0.334	O43184.pdb.gz	ADA12_HUMAN Disintegrin and metalloproteinase domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ADAM12 PE=1 SV=3
4	AFDB:Q61824	0.621	0.572	7.089E-79	903	0.377	0.342	Q61824.pdb.gz	ADA12_MOUSE Disintegrin and metalloproteinase domain-containing protein 12 OS=Mus musculus OX=10090 GN=Adam12 PE=1 SV=2
5	AFDB:P70505	0.544	0.561	3.919E-77	789	0.332	0.345	P70505.pdb.gz	ADAM1_RAT Disintegrin and metalloproteinase domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Adam1 PE=2 SV=1
6	AFDB:Q9UKF2	0.391	0.405	7.722E-77	790	0.339	0.352	Q9UKF2.pdb.gz	ADA30_HUMAN Disintegrin and metalloproteinase domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ADAM30 PE=1 SV=2
7	AFDB:Q60813	0.619	0.637	8.171E-77	791	0.330	0.341	Q60813.pdb.gz	ADM1A_MOUSE Disintegrin and metalloproteinase domain-containing protein 1a OS=Mus musculus OX=10090 GN=Adam1a PE=2 SV=3
8	AFDB:O43506	0.400	0.449	2.136E-76	726	0.325	0.366	O43506.pdb.gz	ADA20_HUMAN Disintegrin and metalloproteinase domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ADAM20 PE=2 SV=2
9	AFDB:Q9UKJ8	0.393	0.443	2.391E-76	722	0.316	0.359	Q9UKJ8.pdb.gz	ADA21_HUMAN Disintegrin and metalloproteinase domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ADAM21 PE=1 SV=2
10	AFDB:Q9UKF5	0.394	0.394	9.283E-76	820	0.328	0.328	Q9UKF5.pdb.gz	ADA29_HUMAN Disintegrin and metalloproteinase domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ADAM29 PE=1 SV=3
11	PDB:4q1lA	0.233	0.920	3.943E-19	202	0.078	0.317	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:2x7mA	0.155	0.584	2.100E-4	180	0.034	0.156	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
13	PDB:7ufgA	0.137	0.100	6.981E-3	1151	0.073	0.052	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:7ufgB	0.144	0.105	9.261E-3	1182	0.057	0.040	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:6rrrA	0.045	0.068	2.561E-2	472	0.017	0.030	6rrrA.pdb.gz
16	PDB:1aklA	0.120	0.189	2.710E-2	470	0.037	0.064	1aklA.pdb.gz	Crystal structure of the unliganded alkaline protease from Pseudomonas aeruginosa IFO3080 and its conformational changes on ligand binding.
17	PDB:5guhA	0.105	0.112	6.694E-2	759	0.023	0.025	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
18	PDB:4binA	0.068	0.124	1.851E-1	348	0.035	0.083	4binA.pdb.gz	The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.
19	PDB:5a60A	0.066	0.110	2.321E-1	429	0.018	0.035	5a60A.pdb.gz	Structural Determinants for Substrate Binding and Catalysis in Triphosphate Tunnel Metalloenzymes.
20	PDB:2qimA	0.050	0.153	2.456E-1	157	0.015	0.076	2qimA.pdb.gz	Lupinus luteus pathogenesis-related protein as a reservoir for cytokinin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y224	0.0	1377	852	0.816	0.784	A0A8I5Y224_RAT ADAM metallopeptidase domain 9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=1 SV=1
2	A0A8I6AAS7	0.0	1339	827	0.827	0.819	A0A8I6AAS7_RAT ADAM metallopeptidase domain 9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=1 SV=1
3	A0AVL1	0.0	1440	712	0.844	0.971	A0AVL1_HUMAN ADAM metallopeptidase domain 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1
4	E9PTA4	0.0	1374	845	0.850	0.824	E9PTA4_RAT ADAM metallopeptidase domain 9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=1 SV=2
5	Q13443	0.0	1705	819	1.000	1.000	ADAM9_HUMAN Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1
6	Q58GH6	0.0	1375	845	0.850	0.824	Q58GH6_RAT ADAM9 OS=Rattus norvegicus OX=10116 GN=Adam9 PE=2 SV=1
7	Q61072	0.0	1397	845	0.857	0.831	ADAM9_MOUSE Disintegrin and metalloproteinase domain-containing protein 9 OS=Mus musculus OX=10090 GN=Adam9 PE=1 SV=2
8	Q9UKJ8	5.31e-169	508	722	0.311	0.353	ADA21_HUMAN Disintegrin and metalloproteinase domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ADAM21 PE=1 SV=2
9	Q9JI76	2.91e-164	496	729	0.325	0.365	ADA21_MOUSE Disintegrin and metalloproteinase domain-containing protein 21 OS=Mus musculus OX=10090 GN=Adam21 PE=2 SV=1
10	O43506	4.04e-164	495	726	0.330	0.372	ADA20_HUMAN Disintegrin and metalloproteinase domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ADAM20 PE=2 SV=2
11	Q9UKF5	1.36e-161	492	820	0.343	0.343	ADA29_HUMAN Disintegrin and metalloproteinase domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ADAM29 PE=1 SV=3
12	O43184	2.94e-160	491	909	0.379	0.341	ADA12_HUMAN Disintegrin and metalloproteinase domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ADAM12 PE=1 SV=3
13	Q9R158	4.94e-159	481	697	0.305	0.359	AD26A_MOUSE Disintegrin and metalloproteinase domain-containing protein 26A OS=Mus musculus OX=10090 GN=Adam26a PE=1 SV=2
14	Q61824	7.97e-157	482	903	0.374	0.339	ADA12_MOUSE Disintegrin and metalloproteinase domain-containing protein 12 OS=Mus musculus OX=10090 GN=Adam12 PE=1 SV=2
15	Q9UKF2	5.29e-155	474	790	0.335	0.347	ADA30_HUMAN Disintegrin and metalloproteinase domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ADAM30 PE=1 SV=2
16	Q8TC27	4.96e-152	466	787	0.314	0.327	ADA32_HUMAN Disintegrin and metalloproteinase domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ADAM32 PE=1 SV=2
17	Q60813	3.38e-151	464	791	0.310	0.321	ADM1A_MOUSE Disintegrin and metalloproteinase domain-containing protein 1a OS=Mus musculus OX=10090 GN=Adam1a PE=2 SV=3
18	Q9R160	1.91e-148	456	761	0.297	0.319	ADA24_MOUSE Disintegrin and metalloproteinase domain-containing protein 24 OS=Mus musculus OX=10090 GN=Adam24 PE=1 SV=2
19	P70505	4.76e-148	456	789	0.309	0.321	ADAM1_RAT Disintegrin and metalloproteinase domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Adam1 PE=2 SV=1
20	Q811Q4	1.44e-147	454	763	0.302	0.324	ADA29_MOUSE Disintegrin and metalloproteinase domain-containing protein 29 OS=Mus musculus OX=10090 GN=Adam29 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	1.5e+02	14.3	ADAMTS cysteine-rich domain 2
2	PF08516 ADAM_CR	5.1e-31	118.9	ADAM cysteine-rich
3	PF00200 Disintegrin	8.1e-16	69.9	Disintegrin
4	PF00413 Peptidase_M10	97	14.2	Matrixin
5	PF05572 Peptidase_M43	1.2e+02	14.1	Pregnancy-associated plasma protein-A
6	PF12388 Peptidase_M57	7.3	17.7	Dual-action HEIGH metallo-peptidase
7	PF10462 Peptidase_M66	53	14.2	Peptidase M66
8	PF01562 Pep_M12B_propep	1.6e-28	111.1	Reprolysin family propeptide
9	PF01421 Reprolysin	1.5e-66	235.7	Reprolysin (M12B) family zinc metalloprotease
10	PF13574 Reprolysin_2	2.8e-06	38.9	Metallo-peptidase family M12B Reprolysin-like
11	PF13582 Reprolysin_3	8.7e-13	60.3	Metallo-peptidase family M12B Reprolysin-like
12	PF13583 Reprolysin_4	3.7e-07	41.5	Metallo-peptidase family M12B Reprolysin-like
13	PF13688 Reprolysin_5	1.2e-16	73.0	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419446

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340937	0.935	Collagen alpha-1(XVII) chain
2	9606.ENSP00000376024	0.891	Sorting nexin-9
3	9606.ENSP00000235310	0.866	Mitotic spindle assembly checkpoint protein MAD2B
4	9606.ENSP00000261023	0.776	Integrin alpha-V
5	9606.ENSP00000369981	0.761	Endophilin-A1
6	9606.ENSP00000296509	0.720	Mitotic spindle assembly checkpoint protein MAD2A
7	9606.ENSP00000379350	0.690	Integrin beta-1
8	9606.ENSP00000362680	0.681	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000378217	0.677	Protein kinase C delta type
10	9606.ENSP00000284981	0.602	Amyloid-beta A4 protein
11	9606.ENSP00000317332	0.595	Sorting nexin-18
12	9606.ENSP00000318585	0.591	Beta-secretase 1
13	9606.ENSP00000230990	0.579	Proheparin-binding EGF-like growth factor
14	9606.ENSP00000296181	0.574	Integrin beta-5
15	9606.ENSP00000294785	0.567	Nicastrin
16	9606.ENSP00000440945	0.556	Protein kinase C and casein kinase substrate in neurons protein 3
17	9606.ENSP00000240100	0.545	Dual specificity protein phosphatase 4
18	9606.ENSP00000358105	0.518	Gamma-secretase subunit APH-1A
19	9606.ENSP00000468411	0.514	Gamma-secretase subunit PEN-2
20	9606.ENSP00000351697	0.510	DNA polymerase zeta catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	0.997	metallopeptidase activity
GO:0019904	0.996	protein domain specific binding
GO:0017124	0.991	SH3 domain binding
GO:0004175	0.961	endopeptidase activity
GO:0050839	0.956	cell adhesion molecule binding
GO:0005178	0.932	integrin binding
GO:0004222	0.897	metalloendopeptidase activity
GO:0043236	0.728	laminin binding
GO:0005518	0.579	collagen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050789	0.967	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0048518	0.963	positive regulation of biological process
GO:0009987	0.956	cellular process
GO:0006950	0.914	response to stress
GO:0042221	0.853	response to chemical
GO:0019222	0.806	regulation of metabolic process
GO:0048522	0.787	positive regulation of cellular process
GO:0008152	0.718	metabolic process
GO:0060255	0.717	regulation of macromolecule metabolic process
GO:0051716	0.685	cellular response to stimulus
GO:0071704	0.668	organic substance metabolic process
GO:0044238	0.667	primary metabolic process
GO:0006807	0.628	nitrogen compound metabolic process
GO:0023052	0.614	signaling
GO:0009893	0.605	positive regulation of metabolic process
GO:0048583	0.603	regulation of response to stimulus
GO:0010604	0.602	positive regulation of macromolecule metabolic process
GO:0023051	0.597	regulation of signaling
GO:0010646	0.589	regulation of cell communication
GO:0032501	0.582	multicellular organismal process
GO:0032502	0.576	developmental process
GO:0043170	0.575	macromolecule metabolic process
GO:0051171	0.534	regulation of nitrogen compound metabolic process
GO:0080090	0.532	regulation of primary metabolic process
GO:0065009	0.520	regulation of molecular function
GO:0007165	0.486	signal transduction
GO:0051246	0.484	regulation of protein metabolic process
GO:0031323	0.481	regulation of cellular metabolic process
GO:0051173	0.474	positive regulation of nitrogen compound metabolic process
GO:0048856	0.472	anatomical structure development
GO:0050790	0.460	regulation of catalytic activity
GO:0007155	0.454	cell adhesion
GO:0009966	0.429	regulation of signal transduction
GO:1901564	0.428	organonitrogen compound metabolic process
GO:0019538	0.422	protein metabolic process
GO:0071840	0.412	cellular component organization or biogenesis
GO:0051247	0.398	positive regulation of protein metabolic process
GO:0007166	0.357	cell surface receptor signaling pathway
GO:0030334	0.343	regulation of cell migration
GO:0031325	0.333	positive regulation of cellular metabolic process
GO:0043085	0.317	positive regulation of catalytic activity
GO:0042325	0.317	regulation of phosphorylation
GO:0016043	0.305	cellular component organization
GO:0048519	0.304	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	0.999	membrane
GO:0005622	0.997	intracellular anatomical structure
GO:0043227	0.996	membrane-bounded organelle
GO:0005886	0.985	plasma membrane
GO:0005737	0.980	cytoplasm
GO:0043229	0.975	intracellular organelle
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0005576	0.960	extracellular region
GO:0031982	0.933	vesicle
GO:0012505	0.927	endomembrane system
GO:0005615	0.895	extracellular space
GO:0030054	0.834	cell junction
GO:0070062	0.811	extracellular exosome
GO:0009986	0.733	cell surface
GO:0070161	0.692	anchoring junction
GO:0030055	0.677	cell-substrate junction
GO:0098590	0.536	plasma membrane region
GO:0031410	0.313	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.997	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.897	Metalloendopeptidases.

[back to server]