StarFunc result for job id Q13459

User Input

>input (2157 residues)
MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKDAIASLRLDGT
KCYVLVEVKESGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKY
VHMQLVAQATATRRLVERGLLPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAG
SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
YFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRA
TGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGMSSPGA
QSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKS
KGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE
ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
QFQVLLPKDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKI
LLLQSWFRMVLERRHFLQMKRAAVTIQACWRSYRVRRALERTQAAVYLQASWRGYWQRKL
YRHQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEEKEREALEAARAGAEEGGQGQAAGG
QQVAEQGPEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEAPSPEKTLPPQKTVAAESHEK
VPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKESRED
ETLLVVETEAENTSQKQPTEQPQAMAVGKVSEETEKTLPSGSPRPGQLERPTSLALDSRV
SPPAPGSAPETPEDKSKPCGSPRVQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVA
AASPSAMLSQSLDLSDRHRATGAALTPTEERRTSFSTSDVSKLLPSLAKAQPAAETTDGE
RSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENA
VSGHVVLEATTMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
VFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIHV
GYKDLMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKK
RKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSH
CSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAA
NRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEK
QEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALLEDVNRMSPGALAIIFAPCLLRCPDN
SDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPL
KLGFSSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKEDI
TYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPALPCPGAPTPSPLPTV
AAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPP
ARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQTNG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RTY4	0.479	0.412	0.000	2548	0.455	0.385	B2RTY4.pdb.gz	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2
2	AFDB:Q13459	1.000	1.000	0.000	2157	1.000	1.000	Q13459.pdb.gz	MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3
3	AFDB:Q8C170	0.477	0.410	0.000	2542	0.452	0.384	Q8C170.pdb.gz	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
4	AFDB:Q9QY06	0.558	0.569	0.000	2114	0.832	0.849	Q9QY06.pdb.gz	MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus OX=10090 GN=Myo9b PE=1 SV=2
5	AFDB:Q9Z1N3	0.395	0.336	0.000	2626	0.463	0.380	Q9Z1N3.pdb.gz	MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus OX=10116 GN=Myo9a PE=1 SV=1
6	AFDB:Q8IPH8	0.290	0.294	1.919E-61	2122	0.157	0.160	Q8IPH8.pdb.gz	Q8IPH8_DROME Myosin 28B1, isoform B OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=1
7	AFDB:P22467	0.289	0.606	2.254E-59	994	0.128	0.279	P22467.pdb.gz	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
8	AFDB:Q9TW28	0.303	0.374	1.829E-58	1737	0.164	0.204	Q9TW28.pdb.gz	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
9	AFDB:P21271	0.278	0.328	4.519E-57	1818	0.144	0.171	P21271.pdb.gz	MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus OX=10090 GN=Myo5b PE=1 SV=2
10	AFDB:Q9NQX4	0.275	0.339	7.376E-57	1742	0.141	0.175	Q9NQX4.pdb.gz	MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens OX=9606 GN=MYO5C PE=1 SV=2
11	PDB:4anjA	0.283	0.603	4.789E-52	995	0.118	0.256	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
12	PDB:6ycxB	0.294	0.749	1.000E-46	817	0.107	0.283	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
13	PDB:4pa0A	0.261	0.556	5.434E-46	974	0.119	0.263	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:4pa0B	0.261	0.588	1.014E-45	920	0.117	0.274	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
15	PDB:4p7hB	0.259	0.566	2.863E-44	952	0.110	0.249	4p7hB.pdb.gz
16	PDB:7mf3B	0.305	0.702	2.117E-40	896	0.128	0.309	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.288	0.614	2.719E-38	954	0.130	0.295	5tbyA.pdb.gz
18	PDB:1xa6A	0.090	0.455	1.715E-13	399	0.038	0.208	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
19	PDB:3cxlA	0.090	0.447	1.065E-12	402	0.038	0.206	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
20	PDB:5c2kA	0.086	0.469	1.430E-10	382	0.026	0.147	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RTY4	0.0	1267	2548	0.312	0.264	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2
2	E7EZG2	0.0	1260	2522	0.324	0.277	MY9AA_DANRE Unconventional myosin-IXAa OS=Danio rerio OX=7955 GN=myo9aa PE=3 SV=1
3	E7F3F0	0.0	1101	2286	0.285	0.269	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
4	F0IWT2	0.0	786	1880	0.202	0.232	F0IWT2_CAEEL Unconventional myosin-IXa-like OS=Caenorhabditis elegans OX=6239 GN=hum-7 PE=1 SV=1
5	H2L082	0.0	785	1867	0.203	0.235	H2L082_CAEEL Unconventional myosin-IXa-like OS=Caenorhabditis elegans OX=6239 GN=hum-7 PE=1 SV=1
6	M0R0P8	0.0	4457	2157	1.000	1.000	M0R0P8_HUMAN Myosin IXB OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=1
7	M0R300	0.0	4268	2071	0.960	1.000	M0R300_HUMAN Myosin IXB (Fragment) OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=8
8	Q13459	0.0	4458	2157	1.000	1.000	MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3
9	Q63358	0.0	3377	1980	0.783	0.853	MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus OX=10116 GN=Myo9b PE=1 SV=1
10	Q8C170	0.0	1264	2542	0.312	0.265	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
11	Q8WVD2	0.0	1040	501	0.232	1.000	Q8WVD2_HUMAN MYO9B protein (Fragment) OS=Homo sapiens OX=9606 GN=MYO9B PE=2 SV=2
12	Q9QY06	0.0	3597	2114	0.834	0.851	MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus OX=10090 GN=Myo9b PE=1 SV=2
13	Q9Z1N3	0.0	1246	2626	0.314	0.258	MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus OX=10116 GN=Myo9a PE=1 SV=1
14	Q9U1M8	1.08e-134	473	2357	0.114	0.104	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
15	A0A0G2JTE7	1.54e-134	474	3494	0.111	0.068	A0A0G2JTE7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
16	A0A0G2K1F7	1.55e-134	474	3512	0.111	0.068	A0A0G2K1F7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
17	Q9QZZ4	4.95e-134	473	3511	0.110	0.068	MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus OX=10090 GN=Myo15a PE=1 SV=2
18	Q9UKN7	4.19e-132	467	3530	0.110	0.067	MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens OX=9606 GN=MYO15A PE=1 SV=2
19	Q8IPH7	4.93e-132	444	1034	0.107	0.223	Q8IPH7_DROME Myosin 28B1, isoform C OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=2
20	Q7YU72	5.30e-132	444	1035	0.107	0.223	Q7YU72_DROME RH39293p OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	2.6e+02	13.3	AAA domain
2	PF00130 C1_1	0.23	22.7	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF00612 IQ	8.3e-13	57.9	IQ calmodulin-binding motif
4	PF00063 Myosin_head	9.3e-211	713.3	Myosin head (motor domain)
5	PF00788 RA	9.3e-14	63.2	Ras association (RalGDS/AF-6) domain
6	PF00620 RhoGAP	2.4e-41	152.5	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000025065

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000012527	0.934	Ras homolog family member A
2	9593.ENSGGOP00000002701	0.838	Ras homolog family member C
3	9593.ENSGGOP00000028605	0.756	Rho GTPase activating protein 15
4	9593.ENSGGOP00000012251	0.753	Ras homolog family member G
5	9593.ENSGGOP00000012875	0.751	Ras homolog family member B
6	9593.ENSGGOP00000025053	0.751	Cell division cycle 42
7	9593.ENSGGOP00000007740	0.749	Ras homolog family member U
8	9593.ENSGGOP00000007769	0.749	Ras homolog family member J
9	9593.ENSGGOP00000014613	0.749	Ras homolog family member D
10	9593.ENSGGOP00000027163	0.749	Ras homolog family member F (in filopodia)
11	9593.ENSGGOP00000010349	0.741	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
12	9593.ENSGGOP00000000790	0.737	Rho GTPase activating protein 27
13	9593.ENSGGOP00000011318	0.737	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
14	9593.ENSGGOP00000017243	0.737	Uncharacterized protein
15	9593.ENSGGOP00000004247	0.736	Rho-related BTB domain containing 3
16	9593.ENSGGOP00000006914	0.736	Rho family GTPase 1
17	9593.ENSGGOP00000009596	0.736	Rho family GTPase 2
18	9593.ENSGGOP00000012268	0.736	Rho family GTPase 3
19	9593.ENSGGOP00000017017	0.736	Ras homolog family member V
20	9593.ENSGGOP00000019115	0.736	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000146	0.999	microfilament motor activity
GO:0005096	0.999	GTPase activator activity
GO:0043168	0.996	anion binding
GO:0008092	0.995	cytoskeletal protein binding
GO:0032559	0.995	adenyl ribonucleotide binding
GO:0043531	0.992	ADP binding
GO:0003779	0.990	actin binding
GO:0035639	0.974	purine ribonucleoside triphosphate binding
GO:0019899	0.968	enzyme binding
GO:0005524	0.964	ATP binding
GO:0031267	0.961	small GTPase binding
GO:0005516	0.936	calmodulin binding
GO:0005102	0.639	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.993	response to stimulus
GO:0007154	0.956	cell communication
GO:0051716	0.956	cellular response to stimulus
GO:0023052	0.955	signaling
GO:0007165	0.954	signal transduction
GO:0007264	0.937	small GTPase mediated signal transduction
GO:0007266	0.855	Rho protein signal transduction
GO:0002376	0.586	immune system process
GO:0071840	0.371	cellular component organization or biogenesis
GO:0016043	0.343	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005886	0.970	plasma membrane
GO:0042995	0.919	cell projection
GO:0120025	0.912	plasma membrane bounded cell projection
GO:0015629	0.906	actin cytoskeleton
GO:0043227	0.899	membrane-bounded organelle
GO:0031982	0.852	vesicle
GO:0005938	0.795	cell cortex
GO:0031252	0.774	cell leading edge
GO:0043231	0.699	intracellular membrane-bounded organelle
GO:0099080	0.693	supramolecular complex
GO:0043005	0.557	neuron projection
GO:0099513	0.547	polymeric cytoskeletal fiber
GO:0048471	0.450	perinuclear region of cytoplasm
GO:0032991	0.435	protein-containing complex
GO:0005884	0.430	actin filament
GO:0098858	0.302	actin-based cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.999	myosin ATPase.

[back to server]