StarFunc result for job id Q13461

User Input

>input (319 residues)
MAGRSDMDPPAAFSGFPALPAVAPSGPPPSPLAGAEPGREPEEAAAGRGEAAPTPAPGPG
RRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIR
HNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAELPAHAAAAP
GPPLPFPYAPYAPAPGPALLVPPPSAGPGPSPPARLFSVDSLVNLQPELAGLGAPEPPCC
AAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAEPLLALAGPAAALGPLS
PGEAYLRQPGFASGLERYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13461	0.999	0.999	5.478E-51	319	1.000	1.000	Q13461.pdb.gz	FOXE3_HUMAN Forkhead box protein E3 OS=Homo sapiens OX=9606 GN=FOXE3 PE=1 SV=2
2	AFDB:P79772	0.320	0.260	8.867E-21	394	0.376	0.305	P79772.pdb.gz	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
3	AFDB:Q61345	0.335	0.236	2.516E-20	456	0.433	0.303	Q61345.pdb.gz	FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus OX=10090 GN=Foxd1 PE=2 SV=2
4	AFDB:Q9DEN3	0.331	0.284	8.136E-20	371	0.342	0.294	Q9DEN3.pdb.gz	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
5	AFDB:Q9PVY9	0.330	0.229	2.027E-19	465	0.354	0.243	Q9PVY9.pdb.gz	FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis OX=8355 GN=foxc2-a PE=2 SV=1
6	AFDB:B0R0B2	0.337	0.335	2.309E-19	321	0.345	0.343	B0R0B2.pdb.gz
7	AFDB:Q16676	0.332	0.229	2.464E-19	465	0.433	0.297	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
8	AFDB:P32183	0.366	0.332	9.689E-19	354	0.332	0.299	P32183.pdb.gz	FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus OX=10116 GN=Foxa3 PE=1 SV=1
9	AFDB:Q9PRJ8	0.337	0.306	1.178E-18	352	0.329	0.298	Q9PRJ8.pdb.gz	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
10	AFDB:O60548	0.324	0.210	2.750E-18	495	0.473	0.305	O60548.pdb.gz	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
11	PDB:2hdcA	0.248	0.676	1.373E-10	97	0.219	0.722	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:7k5yU	0.186	0.630	4.279E-2	75	0.041	0.173	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
13	PDB:4a6dA	0.167	0.156	7.209E-2	345	0.050	0.046	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
14	PDB:2nyxB	0.145	0.288	7.694E-2	147	0.034	0.075	2nyxB.pdb.gz
15	PDB:2qbyB	0.188	0.166	1.138E-1	368	0.028	0.024	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
16	PDB:4etsB	0.165	0.328	1.138E-1	149	0.044	0.094	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
17	PDB:5k1yD	0.175	0.528	1.138E-1	92	0.034	0.120	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
18	PDB:3euhB	0.214	0.213	1.576E-1	321	0.038	0.037	3euhB.pdb.gz
19	PDB:7a6hO	0.171	0.113	1.576E-1	512	0.038	0.023	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
20	PDB:2fe3B	0.165	0.339	2.046E-1	143	0.022	0.049	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13461	0.0	602	319	1.000	1.000	FOXE3_HUMAN Forkhead box protein E3 OS=Homo sapiens OX=9606 GN=FOXE3 PE=1 SV=2
2	Q9QY14	2.11e-110	324	288	0.721	0.799	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
3	B0UXI3	8.08e-68	219	422	0.458	0.346	B0UXI3_DANRE Forkhead box E3 OS=Danio rerio OX=7955 GN=foxe3 PE=2 SV=1
4	Q9PTK2	7.59e-66	213	365	0.420	0.367	FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis OX=8355 GN=foxe4 PE=2 SV=1
5	O00358	1.95e-52	178	373	0.295	0.252	FOXE1_HUMAN Forkhead box protein E1 OS=Homo sapiens OX=9606 GN=FOXE1 PE=1 SV=3
6	Q8R2I0	7.56e-52	177	371	0.245	0.210	FOXE1_MOUSE Forkhead box protein E1 OS=Mus musculus OX=10090 GN=Foxe1 PE=1 SV=2
7	Q12950	7.15e-48	168	439	0.270	0.196	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
8	Q18694	1.91e-47	164	333	0.229	0.219	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
9	Q9DEN4	3.24e-45	159	371	0.235	0.202	FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis OX=8355 GN=foxd3-a PE=1 SV=1
10	P32183	8.24e-45	158	354	0.216	0.195	FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus OX=10116 GN=Foxa3 PE=1 SV=1
11	P35584	1.58e-44	157	353	0.216	0.195	FOXA3_MOUSE Hepatocyte nuclear factor 3-gamma OS=Mus musculus OX=10090 GN=Foxa3 PE=1 SV=1
12	Q9DEN3	1.70e-44	157	371	0.229	0.197	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
13	Q9PVZ3	4.05e-44	159	492	0.241	0.157	FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis OX=8355 GN=foxc1-a PE=2 SV=1
14	Q9PSY4	4.44e-44	155	345	0.282	0.261	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
15	Q7SY22	6.76e-44	155	363	0.270	0.237	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
16	P55318	1.11e-43	155	350	0.201	0.183	FOXA3_HUMAN Hepatocyte nuclear factor 3-gamma OS=Homo sapiens OX=9606 GN=FOXA3 PE=1 SV=2
17	Q9PT68	2.95e-43	154	353	0.213	0.193	FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis OX=8355 GN=foxd5-b PE=2 SV=1
18	O93312	5.84e-43	151	296	0.191	0.206	O93312_DANRE Forkhead box B1b OS=Danio rerio OX=7955 GN=foxb1.1 PE=2 SV=1
19	O73779	6.39e-43	151	297	0.191	0.205	O73779_DANRE Fork head domain protein FKD3 OS=Danio rerio OX=7955 GN=foxb1.2 PE=2 SV=1
20	Q99853	1.02e-42	151	325	0.191	0.188	FOXB1_HUMAN Forkhead box protein B1 OS=Homo sapiens OX=9606 GN=FOXB1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	4.5e-32	121.4	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334472

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441039	0.940	G-protein coupled receptor 161
2	9606.ENSP00000359019	0.786	Pituitary homeobox 3
3	9606.ENSP00000404100	0.756	Paired box protein Pax-6
4	9606.ENSP00000304169	0.666	Pituitary homeobox 2
5	9606.ENSP00000376287	0.661	Beta-crystallin S
6	9606.ENSP00000327048	0.644	Transcription factor Maf
7	9606.ENSP00000369251	0.613	Putative nucleotidyltransferase MAB21L1
8	9606.ENSP00000291554	0.611	Crystallin, alpha A
9	9606.ENSP00000482816	0.611	Alpha-crystallin A chain
10	9606.ENSP00000343002	0.607	Beta-1,3-glucosyltransferase
11	9606.ENSP00000260653	0.598	Homeobox protein SIX3
12	9606.ENSP00000261980	0.572	Visual system homeobox 2
13	9606.ENSP00000304987	0.568	Phakinin
14	9606.ENSP00000358238	0.561	Gap junction alpha-8 protein
15	9606.ENSP00000346805	0.559	Beta-crystallin A4
16	9606.ENSP00000284000	0.557	CCAAT/enhancer-binding protein gamma
17	9606.ENSP00000312987	0.557	Hepatocyte nuclear factor 4-alpha
18	9606.ENSP00000225387	0.537	Beta-crystallin A3
19	9606.ENSP00000381273	0.536	Beta-crystallin B2
20	9606.ENSP00000347444	0.534	Tudor domain-containing protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	0.998	sequence-specific DNA binding
GO:0003690	0.986	double-stranded DNA binding
GO:1990837	0.975	sequence-specific double-stranded DNA binding
GO:0005515	0.932	protein binding
GO:0000976	0.847	transcription cis-regulatory region binding
GO:0000981	0.643	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.346	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.315	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.965	cellular process
GO:0007275	0.953	multicellular organism development
GO:0048513	0.928	animal organ development
GO:0048731	0.914	system development
GO:0048519	0.684	negative regulation of biological process
GO:0019222	0.668	regulation of metabolic process
GO:0048523	0.663	negative regulation of cellular process
GO:0060255	0.629	regulation of macromolecule metabolic process
GO:0010468	0.589	regulation of gene expression
GO:0080090	0.581	regulation of primary metabolic process
GO:0051171	0.581	regulation of nitrogen compound metabolic process
GO:0048518	0.577	positive regulation of biological process
GO:0031323	0.577	regulation of cellular metabolic process
GO:0019219	0.551	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.549	regulation of macromolecule biosynthetic process
GO:0031326	0.549	regulation of cellular biosynthetic process
GO:0006355	0.540	regulation of DNA-templated transcription
GO:0048522	0.520	positive regulation of cellular process
GO:0001654	0.435	eye development
GO:0071704	0.379	organic substance metabolic process
GO:0044237	0.377	cellular metabolic process
GO:0044238	0.373	primary metabolic process
GO:0009653	0.357	anatomical structure morphogenesis
GO:0006357	0.340	regulation of transcription by RNA polymerase II
GO:0009893	0.322	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.984	protein-containing complex
GO:0005667	0.542	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]