StarFunc result for job id Q13464

User Input

>input (1354 residues)
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IHT4	0.305	0.296	0.000	1396	0.627	0.608	A0A0R4IHT4.pdb.gz
2	AFDB:A0A0R4IQJ2	0.301	0.291	0.000	1401	0.558	0.540	A0A0R4IQJ2.pdb.gz
3	AFDB:A0A0R4IVY5	0.302	0.301	0.000	1359	0.756	0.753	A0A0R4IVY5.pdb.gz	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
4	AFDB:M3TYT0	0.304	0.296	0.000	1388	0.659	0.643	M3TYT0.pdb.gz	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
5	AFDB:Q63644	0.306	0.302	0.000	1369	0.959	0.948	Q63644.pdb.gz	ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Rock1 PE=1 SV=1
6	AFDB:Q9VXE3	0.334	0.326	9.842E-96	1390	0.437	0.426	Q9VXE3.pdb.gz	Q9VXE3_DROME Rho-associated protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=1 SV=1
7	AFDB:P92199	0.299	0.344	3.416E-78	1173	0.331	0.382	P92199.pdb.gz	ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans OX=6239 GN=let-502 PE=1 SV=1
8	AFDB:O54874	0.293	0.231	3.343E-50	1732	0.257	0.201	O54874.pdb.gz	MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus OX=10116 GN=Cdc42bpa PE=1 SV=1
9	AFDB:O14578	0.288	0.195	2.282E-49	2027	0.251	0.168	O14578.pdb.gz	CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2
10	AFDB:E9PSL7	0.298	0.200	2.825E-49	2055	0.258	0.170	E9PSL7.pdb.gz	CTRO_RAT Citron rho-interacting kinase OS=Rattus norvegicus OX=10116 GN=Cit PE=1 SV=1
11	PDB:6byrA	0.219	0.711	1.090E-28	405	0.097	0.323	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:5x3fB	0.195	0.718	2.776E-25	349	0.079	0.307	5x3fB.pdb.gz
13	PDB:6pjxA	0.218	0.522	8.071E-25	543	0.086	0.215	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
14	PDB:4mk0A	0.215	0.446	8.979E-25	631	0.076	0.163	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:3pvuA	0.199	0.429	9.471E-25	609	0.073	0.163	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:3c4wB	0.214	0.538	1.376E-24	519	0.082	0.214	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:3nynA	0.219	0.514	6.129E-24	554	0.077	0.188	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
18	PDB:4yhjA	0.215	0.555	3.565E-23	501	0.073	0.198	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
19	PDB:3pfqA	0.198	0.503	2.073E-22	523	0.079	0.205	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	PDB:6s9wA	0.188	0.583	4.149E-22	411	0.083	0.275	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IVY5	2122	1359	0.757	0.754	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
2	A0A2P9DU05	1774	1388	0.658	0.642	A0A2P9DU05_HUMAN Rho-associated protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=2 SV=1
3	A0A8C0NIR0	2744	1355	0.977	0.976	A0A8C0NIR0_CANLF Rho-associated protein kinase OS=Canis lupus familiaris OX=9615 GN=ROCK1 PE=1 SV=1
4	E9PF63	1366	1145	0.520	0.615	E9PF63_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=1
5	F1MF50	2735	1356	0.974	0.973	F1MF50_BOVIN Rho-associated protein kinase OS=Bos taurus OX=9913 GN=ROCK1 PE=3 SV=3
6	I3LFH3	2231	1134	0.806	0.963	I3LFH3_PIG non-specific serine/threonine protein kinase OS=Sus scrofa OX=9823 GN=ROCK1 PE=1 SV=4
7	M3TYT0	1776	1388	0.659	0.643	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1
8	O75116	1774	1388	0.658	0.642	ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4
9	P70335	2720	1354	0.966	0.966	ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Rock1 PE=1 SV=1
10	P70336	1765	1388	0.654	0.638	ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus OX=10090 GN=Rock2 PE=1 SV=1
11	Q13464	2795	1354	1.000	1.000	ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1
12	Q28021	1784	1388	0.661	0.645	ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus OX=9913 GN=ROCK2 PE=1 SV=1
13	Q62868	1765	1388	0.655	0.639	ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Rock2 PE=1 SV=2
14	Q63644	2623	1369	0.959	0.948	ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Rock1 PE=1 SV=1
15	Q8MIT6	766	441	0.308	0.946	ROCK1_BOVIN Rho-associated protein kinase 1 (Fragment) OS=Bos taurus OX=9913 GN=ROCK1 PE=1 SV=1
16	Q90Y37	1694	1375	0.638	0.628	Q90Y37_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock2 PE=1 SV=1
17	Q961D4	1052	1390	0.451	0.439	Q961D4_DROME Rho-associated protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=2 SV=1
18	Q9U779	1053	1390	0.451	0.439	Q9U779_DROME Rho-associated protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=2 SV=1
19	Q9VXE3	1053	1390	0.451	0.439	Q9VXE3_DROME Rho-associated protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=1 SV=1
20	X2JC83	1058	1381	0.452	0.443	X2JC83_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Rok PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	11	17.4	Phosphotransferase enzyme family
2	PF00130 C1_1	2.8	19.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF00169 PH	0.0025	29.7	PH domain
4	PF00069 Pkinase	1.3e-59	213.3	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	1.5e-27	108.1	Protein tyrosine and serine/threonine kinase
6	PF08912 Rho_Binding	3.8e-19	80.7	Rho Binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382697

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000364886	0.998	Rho-related GTP-binding protein RhoE
3	9606.ENSP00000389168	0.996	Protein phosphatase 1 regulatory subunit 12A
4	9606.ENSP00000285735	0.994	Rho-related GTP-binding protein RhoC
5	9606.ENSP00000383118	0.984	Cell division control protein 42 homolog
6	9606.ENSP00000339916	0.983	LIM domain kinase 2
7	9606.ENSP00000311032	0.975	Caspase-3
8	9606.ENSP00000279022	0.973	Myosin regulatory light polypeptide 9
9	9606.ENSP00000317985	0.969	Rho-associated protein kinase 2
10	9606.ENSP00000353408	0.968	Moesin
11	9606.ENSP00000384136	0.968	Radixin
12	9606.ENSP00000463559	0.968	Myosin regulatory light chain 12B
13	9606.ENSP00000356042	0.967	Ezrin
14	9606.ENSP00000228841	0.963	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
15	9606.ENSP00000216181	0.962	Myosin-9
16	9606.ENSP00000336740	0.961	LIM domain kinase 1
17	9606.ENSP00000335153	0.957	Heat shock protein HSP 90-alpha
18	9606.ENSP00000361021	0.956	Phosphatase and tensin homolog
19	9606.ENSP00000476755	0.954	Protein phosphatase 1 regulatory subunit 12B
20	9606.ENSP00000371897	0.951	Rho GTPase-activating protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019899	0.457	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.990	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0019222	0.979	regulation of metabolic process
GO:0071840	0.977	cellular component organization or biogenesis
GO:0048519	0.974	negative regulation of biological process
GO:0051716	0.972	cellular response to stimulus
GO:0032501	0.970	multicellular organismal process
GO:0006996	0.965	organelle organization
GO:0023052	0.962	signaling
GO:0050793	0.951	regulation of developmental process
GO:0007154	0.947	cell communication
GO:0048518	0.942	positive regulation of biological process
GO:0007010	0.929	cytoskeleton organization
GO:0048522	0.926	positive regulation of cellular process
GO:0032502	0.917	developmental process
GO:0007165	0.905	signal transduction
GO:0048856	0.885	anatomical structure development
GO:0060255	0.872	regulation of macromolecule metabolic process
GO:0030029	0.847	actin filament-based process
GO:0071559	0.832	response to transforming growth factor beta
GO:0051128	0.809	regulation of cellular component organization
GO:0051239	0.806	regulation of multicellular organismal process
GO:0007275	0.723	multicellular organism development
GO:0010604	0.661	positive regulation of macromolecule metabolic process
GO:0071704	0.655	organic substance metabolic process
GO:0010468	0.599	regulation of gene expression
GO:0044238	0.597	primary metabolic process
GO:0080090	0.577	regulation of primary metabolic process
GO:0009653	0.576	anatomical structure morphogenesis
GO:0051171	0.557	regulation of nitrogen compound metabolic process
GO:0031323	0.556	regulation of cellular metabolic process
GO:0035556	0.542	intracellular signal transduction
GO:0048523	0.534	negative regulation of cellular process
GO:0044237	0.512	cellular metabolic process
GO:0044087	0.506	regulation of cellular component biogenesis
GO:0051246	0.495	regulation of protein metabolic process
GO:0048583	0.486	regulation of response to stimulus
GO:0006807	0.473	nitrogen compound metabolic process
GO:0051173	0.464	positive regulation of nitrogen compound metabolic process
GO:0023051	0.457	regulation of signaling
GO:0065009	0.453	regulation of molecular function
GO:0031325	0.450	positive regulation of cellular metabolic process
GO:0007264	0.437	small GTPase mediated signal transduction
GO:0010646	0.433	regulation of cell communication
GO:0009966	0.424	regulation of signal transduction
GO:0032879	0.418	regulation of localization
GO:0007266	0.411	Rho protein signal transduction
GO:1901888	0.354	regulation of cell junction assembly
GO:0043170	0.341	macromolecule metabolic process
GO:0030155	0.335	regulation of cell adhesion
GO:0048731	0.335	system development
GO:1901564	0.325	organonitrogen compound metabolic process
GO:0042221	0.323	response to chemical
GO:0060341	0.321	regulation of cellular localization
GO:0009889	0.315	regulation of biosynthetic process
GO:0010628	0.313	positive regulation of gene expression
GO:0050790	0.309	regulation of catalytic activity
GO:1902531	0.307	regulation of intracellular signal transduction
GO:0010810	0.306	regulation of cell-substrate adhesion
GO:0071495	0.305	cellular response to endogenous stimulus
GO:0019220	0.303	regulation of phosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.961	cytosol
GO:0043226	0.856	organelle
GO:0043229	0.834	intracellular organelle
GO:0043227	0.598	membrane-bounded organelle
GO:0043231	0.571	intracellular membrane-bounded organelle
GO:0071944	0.402	cell periphery
GO:0005886	0.366	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]