StarFunc result for job id Q13467

User Input

>input (585 residues)
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGG
ECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13467	1.000	1.000	3.424E-88	585	1.000	1.000	Q13467.pdb.gz	FZD5_HUMAN Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2
2	AFDB:B0S6S2	0.621	0.630	2.639E-65	576	0.658	0.668	B0S6S2.pdb.gz
3	AFDB:P58421	0.597	0.624	7.010E-65	559	0.703	0.735	P58421.pdb.gz	FZD5_XENLA Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1
4	AFDB:Q9PTT7	0.598	0.604	1.169E-64	579	0.691	0.698	Q9PTT7.pdb.gz
5	AFDB:B3DIG4	0.584	0.577	1.950E-64	592	0.699	0.691	B3DIG4.pdb.gz	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
6	AFDB:O93274	0.596	0.600	7.873E-64	581	0.687	0.692	O93274.pdb.gz	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
7	AFDB:Q9H461	0.600	0.508	2.042E-62	694	0.697	0.588	Q9H461.pdb.gz	FZD8_HUMAN Frizzled-8 OS=Homo sapiens OX=9606 GN=FZD8 PE=1 SV=1
8	AFDB:Q9VVX3	0.678	0.578	1.167E-54	694	0.569	0.480	Q9VVX3.pdb.gz	FRIZ2_DROME Frizzled-2 OS=Drosophila melanogaster OX=7227 GN=fz2 PE=1 SV=1
9	AFDB:O75084	0.556	0.567	8.222E-48	574	0.475	0.484	O75084.pdb.gz	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
10	AFDB:Q90WM3	0.530	0.535	1.221E-46	580	0.438	0.441	Q90WM3.pdb.gz
11	PDB:7evwR	0.510	0.854	1.844E-25	340	0.316	0.544	7evwR.pdb.gz
12	PDB:7e32R	0.345	0.637	5.879E-7	285	0.067	0.137	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:5w0pC	0.369	0.269	2.373E-6	850	0.097	0.067	5w0pC.pdb.gz
14	PDB:7wicR	0.349	0.638	7.246E-6	288	0.079	0.160	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
15	PDB:7sqoR	0.335	0.639	7.953E-6	270	0.072	0.156	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
16	PDB:6wwzR	0.344	0.574	1.051E-5	310	0.067	0.126	6wwzR.pdb.gz
17	PDB:7vl9R	0.354	0.623	1.154E-5	302	0.074	0.142	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
18	PDB:3aymA	0.349	0.537	1.674E-5	350	0.080	0.134	3aymA.pdb.gz	Crystallographic Analysis of the Primary Photochemical Reaction of Squid Rhodopsin
19	PDB:7f61A	0.349	0.602	1.754E-5	301	0.091	0.176	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
20	PDB:7w2zR	0.348	0.598	2.318E-5	301	0.063	0.123	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DIG4	0.0	823	592	0.713	0.704	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
2	O93274	0.0	798	581	0.682	0.687	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
3	P58421	0.0	840	559	0.718	0.751	FZD5_XENLA Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1
4	Q13467	0.0	1203	585	1.000	1.000	FZD5_HUMAN Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2
5	Q61091	0.0	750	685	0.662	0.565	FZD8_MOUSE Frizzled-8 OS=Mus musculus OX=10090 GN=Fzd8 PE=1 SV=2
6	Q8CHL0	0.0	1163	585	0.964	0.964	FZD5_RAT Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 PE=2 SV=1
7	Q9EQD0	0.0	1162	585	0.966	0.966	FZD5_MOUSE Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3
8	Q9H461	0.0	531	694	0.450	0.379	FZD8_HUMAN Frizzled-8 OS=Homo sapiens OX=9606 GN=FZD8 PE=1 SV=1
9	Q9PWK6	0.0	792	576	0.662	0.672	Q9PWK6_DANRE Frizzled 8b protein OS=Danio rerio OX=7955 GN=ZG06 PE=2 SV=1
10	Q9VVX3	0.0	619	694	0.552	0.465	FRIZ2_DROME Frizzled-2 OS=Drosophila melanogaster OX=7227 GN=fz2 PE=1 SV=1
11	Q9YI00	0.0	819	579	0.694	0.701	Q9YI00_DANRE Frizzled 8a protein OS=Danio rerio OX=7955 GN=zg05 PE=2 SV=1
12	Q14332	1.44e-180	523	565	0.470	0.487	FZD2_HUMAN Frizzled-2 OS=Homo sapiens OX=9606 GN=FZD2 PE=1 SV=1
13	Q9JIP6	2.55e-180	523	570	0.468	0.481	FZD2_MOUSE Frizzled-2 OS=Mus musculus OX=10090 GN=Fzd2 PE=2 SV=1
14	Q6NV44	3.57e-180	522	559	0.456	0.478	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
15	Q90ZT3	4.27e-178	516	559	0.453	0.474	Q90ZT3_DANRE Frizzled 7b OS=Danio rerio OX=7955 GN=zg07 PE=2 SV=1
16	O75084	5.74e-178	517	574	0.475	0.484	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
17	Q61090	2.07e-177	515	572	0.472	0.483	FZD7_MOUSE Frizzled-7 OS=Mus musculus OX=10090 GN=Fzd7 PE=1 SV=2
18	Q9PUK8	2.23e-177	514	549	0.448	0.477	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
19	Q8QFM3	6.05e-177	514	557	0.444	0.467	Q8QFM3_DANRE Frizzled 7a OS=Danio rerio OX=7955 GN=fz7b PE=1 SV=1
20	Q90YL7	1.26e-176	513	550	0.453	0.482	Q90YL7_DANRE Frizzled homolog 2 OS=Danio rerio OX=7955 GN=zfz2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01534 Frizzled	2.5e-135	462.4	Frizzled/Smoothened family membrane region
2	PF01392 Fz	1.2e-28	111.4	Fz domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264634	0.998	Protein Wnt-5a
2	9606.ENSP00000285018	0.998	Protein Wnt-7a
3	9606.ENSP00000368169	0.997	Segment polarity protein dishevelled homolog DVL-1
4	9606.ENSP00000284523	0.993	Protein Wnt-3a
5	9606.ENSP00000261349	0.992	Low-density lipoprotein receptor-related protein 6
6	9606.ENSP00000005340	0.984	Segment polarity protein dishevelled homolog DVL-2
7	9606.ENSP00000344456	0.978	Catenin beta-1
8	9606.ENSP00000316054	0.973	Segment polarity protein dishevelled homolog DVL-3
9	9606.ENSP00000364860	0.968	Tyrosine-protein kinase transmembrane receptor ROR2
10	9606.ENSP00000262320	0.960	Axin-1
11	9606.ENSP00000293549	0.943	Proto-oncogene Wnt-1
12	9606.ENSP00000339191	0.943	Caveolin-1
13	9606.ENSP00000294304	0.942	Low-density lipoprotein receptor-related protein 5
14	9606.ENSP00000360120	0.941	Inactive tyrosine-protein kinase transmembrane receptor ROR1
15	9606.ENSP00000324806	0.940	Glycogen synthase kinase-3 beta
16	9606.ENSP00000257430	0.939	Adenomatous polyposis coli protein
17	9606.ENSP00000222330	0.918	Glycogen synthase kinase-3 alpha
18	9606.ENSP00000379721	0.918	Ubiquitin carboxyl-terminal hydrolase 8
19	9606.ENSP00000265441	0.916	Protein Wnt-2
20	9606.ENSP00000261461	0.914	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	1.000	Wnt-protein binding
GO:0042813	0.999	Wnt receptor activity
GO:0019899	0.664	enzyme binding
GO:0031625	0.364	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050896	0.991	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0007154	0.986	cell communication
GO:0023052	0.985	signaling
GO:0051716	0.981	cellular response to stimulus
GO:0032501	0.978	multicellular organismal process
GO:0007165	0.974	signal transduction
GO:0016055	0.956	Wnt signaling pathway
GO:0032502	0.911	developmental process
GO:0048856	0.903	anatomical structure development
GO:0007275	0.890	multicellular organism development
GO:0060070	0.888	canonical Wnt signaling pathway
GO:0019222	0.773	regulation of metabolic process
GO:0048518	0.771	positive regulation of biological process
GO:0060255	0.734	regulation of macromolecule metabolic process
GO:0048731	0.730	system development
GO:0048513	0.649	animal organ development
GO:0048522	0.643	positive regulation of cellular process
GO:0080090	0.594	regulation of primary metabolic process
GO:0051171	0.589	regulation of nitrogen compound metabolic process
GO:0071840	0.527	cellular component organization or biogenesis
GO:0048519	0.497	negative regulation of biological process
GO:0016043	0.490	cellular component organization
GO:0009893	0.481	positive regulation of metabolic process
GO:0010468	0.469	regulation of gene expression
GO:0031323	0.462	regulation of cellular metabolic process
GO:0010604	0.459	positive regulation of macromolecule metabolic process
GO:0048523	0.448	negative regulation of cellular process
GO:0048583	0.432	regulation of response to stimulus
GO:0010556	0.418	regulation of macromolecule biosynthetic process
GO:0051173	0.417	positive regulation of nitrogen compound metabolic process
GO:0023051	0.408	regulation of signaling
GO:1903506	0.408	regulation of nucleic acid-templated transcription
GO:0006355	0.404	regulation of DNA-templated transcription
GO:0031325	0.400	positive regulation of cellular metabolic process
GO:0009966	0.398	regulation of signal transduction
GO:0009653	0.355	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.991	endomembrane system
GO:0043226	0.975	organelle
GO:0005622	0.970	intracellular anatomical structure
GO:0005737	0.951	cytoplasm
GO:0043227	0.949	membrane-bounded organelle
GO:0043229	0.932	intracellular organelle
GO:0043231	0.923	intracellular membrane-bounded organelle
GO:0031982	0.875	vesicle
GO:0031410	0.868	cytoplasmic vesicle
GO:0031090	0.790	organelle membrane
GO:0030659	0.759	cytoplasmic vesicle membrane
GO:0098588	0.736	bounding membrane of organelle
GO:0030139	0.515	endocytic vesicle
GO:0030666	0.510	endocytic vesicle membrane
GO:0030054	0.452	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]