StarFunc result for job id Q13469

User Input

>input (925 residues)
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAY
PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHE
LIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS
DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR
PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGER
RNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT
GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNT
RVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG
QNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYV
INGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC
LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADA
HRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL
DQTYLDDVNEIIRKEFSGPPARNQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A0I8	0.481	0.478	0.000	931	0.907	0.901	D4A0I8.pdb.gz	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
2	AFDB:A0A1D5PNG2	0.260	0.269	4.470E-61	890	0.439	0.456	A0A1D5PNG2.pdb.gz
3	AFDB:B5B2S1	0.226	0.197	1.051E-48	1075	0.391	0.337	B5B2S1.pdb.gz	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
4	AFDB:F1QXN5	0.214	0.145	2.544E-30	1416	0.225	0.147	F1QXN5.pdb.gz
5	AFDB:K7ER53	0.194	0.277	2.239E-29	639	0.257	0.372	K7ER53.pdb.gz	K7ER53_HUMAN Nuclear factor of activated T cells 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=1
6	AFDB:A1Z8J4	0.068	0.045	2.774E-7	1557	0.161	0.096	A1Z8J4.pdb.gz	A1Z8J4_DROME No mechanoreceptor potential A, isoform A OS=Drosophila melanogaster OX=7227 GN=nompA PE=4 SV=1
7	AFDB:Q15735	0.100	0.093	7.844E-6	1006	0.164	0.151	Q15735.pdb.gz	PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3
8	AFDB:Q9CAD5	0.053	0.055	6.903E-5	883	0.155	0.162	Q9CAD5.pdb.gz	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
9	AFDB:Q54NE5	0.086	0.052	9.000E-5	1918	0.117	0.056	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
10	PDB:3fcsA	0.104	0.105	2.262E-4	913	0.035	0.035	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
11	PDB:4g1eA	0.098	0.095	3.646E-4	964	0.035	0.033	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
12	PDB:5c6wJ	0.083	0.243	4.753E-4	238	0.027	0.105	5c6wJ.pdb.gz
13	PDB:7nxdA	0.104	0.106	8.079E-4	905	0.043	0.044	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
14	AFDB:A0A3B3IU55	0.052	0.050	8.353E-4	977	0.136	0.129	A0A3B3IU55.pdb.gz	A0A3B3IU55_HUMAN Stonin-2 OS=Homo sapiens OX=9606 GN=STON2 PE=1 SV=1
15	PDB:7tvzE	0.105	0.131	9.989E-4	665	0.035	0.048	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
16	PDB:4rtdA	0.100	0.086	1.111E-3	1122	0.034	0.028	4rtdA.pdb.gz
17	PDB:2qhrL	0.105	0.261	1.235E-3	218	0.024	0.101	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
18	PDB:3k6sC	0.120	0.124	1.888E-3	885	0.034	0.035	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
19	PDB:6vxkB	0.094	0.115	1.888E-3	747	0.043	0.054	6vxkB.pdb.gz
20	PDB:6feyB	0.069	0.198	1.991E-3	207	0.024	0.106	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JXL2	0.0	571	925	0.439	0.439	A0A0G2JXL2_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=2
2	A0A8I5ZLE7	0.0	1591	927	0.890	0.888	A0A8I5ZLE7_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
3	A0A8I6A3G2	0.0	1587	927	0.890	0.888	A0A8I6A3G2_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
4	A0A8I6AV80	0.0	1071	674	0.610	0.837	A0A8I6AV80_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
5	A0A8I6G9R9	0.0	1000	654	0.572	0.809	A0A8I6G9R9_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
6	D3ZE20	0.0	572	939	0.439	0.432	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
7	D4A0I8	0.0	1625	931	0.905	0.899	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
8	O95644	0.0	555	943	0.429	0.421	NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3
9	Q13469	0.0	1886	925	1.000	1.000	NFAC2_HUMAN Nuclear factor of activated T-cells, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=NFATC2 PE=1 SV=2
10	Q60591	0.0	1605	927	0.899	0.898	NFAC2_MOUSE Nuclear factor of activated T-cells, cytoplasmic 2 OS=Mus musculus OX=10090 GN=Nfatc2 PE=1 SV=3
11	W5U9R6	1.52e-170	520	879	0.414	0.436	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1
12	A0A1D5PI24	1.72e-169	513	732	0.356	0.449	A0A1D5PI24_CHICK Nuclear factor of activated T cells 1 OS=Gallus gallus OX=9031 GN=NFATC1 PE=4 SV=2
13	O88942	6.46e-166	503	717	0.346	0.446	NFAC1_MOUSE Nuclear factor of activated T-cells, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Nfatc1 PE=1 SV=1
14	Q19AW4	8.65e-164	503	867	0.347	0.370	Q19AW4_DANRE Nuclear factor of activated T-cells calcineurin-dependent 1 OS=Danio rerio OX=7955 GN=si:ch211-198c22.2 PE=2 SV=1
15	I3L3K7	5.08e-135	432	1047	0.277	0.245	I3L3K7_HUMAN Nuclear factor of activated T cells 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
16	B5B2S0	8.78e-135	432	1068	0.278	0.241	B5B2S0_HUMAN Nuclear factor of activated T-cells c3 isoform IB-Xa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
17	H3BRS1	9.17e-135	432	1060	0.277	0.242	H3BRS1_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
18	H3BR83	9.79e-135	432	1053	0.278	0.244	H3BR83_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
19	A0A8I6AB55	1.03e-134	432	1052	0.277	0.243	A0A8I6AB55_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
20	B5B2S1	1.03e-134	432	1075	0.277	0.238	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16179 RHD_dimer	1.1e-22	91.3	Rel homology dimerisation domain
2	PF00554 RHD_DNA_bind	5.7e-19	80.2	Rel homology DNA-binding domain
3	PF01833 TIG	0.0014	30.0	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379330

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306245	0.999	Proto-oncogene c-Fos
2	9606.ENSP00000360266	0.999	Transcription factor AP-1
3	9606.ENSP00000365380	0.999	Forkhead box protein P3
4	9606.ENSP00000370343	0.986	Interferon regulatory factor 4
5	9606.ENSP00000327048	0.985	Transcription factor Maf
6	9606.ENSP00000226730	0.980	Interleukin-2
7	9606.ENSP00000263253	0.967	Histone acetyltransferase p300
8	9606.ENSP00000271555	0.965	Myocyte-specific enhancer factor 2D
9	9606.ENSP00000262367	0.959	CREB-binding protein
10	9606.ENSP00000310170	0.952	Fos-related antigen 1
11	9606.ENSP00000239938	0.949	Early growth response protein 1
12	9606.ENSP00000378974	0.949	Mitogen-activated protein kinase 8
13	9606.ENSP00000324806	0.947	Glycogen synthase kinase-3 beta
14	9606.ENSP00000289902	0.945	High affinity immunoglobulin epsilon receptor subunit gamma
15	9606.ENSP00000303315	0.940	Transcription factor jun-B
16	9606.ENSP00000378323	0.937	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
17	9606.ENSP00000381364	0.936	Calcineurin-binding protein cabin-1
18	9606.ENSP00000234310	0.935	Calcineurin subunit B type 1
19	9606.ENSP00000383003	0.930	Peptidyl-prolyl cis-trans isomerase FKBP1A
20	9606.ENSP00000290158	0.929	Importin subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0001067	0.999	transcription regulatory region nucleic acid binding
GO:0000976	0.957	transcription cis-regulatory region binding
GO:0000981	0.950	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.945	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0019899	0.876	enzyme binding
GO:0000987	0.593	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.582	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.577	DNA-binding transcription activator activity
GO:0001228	0.533	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003824	0.431	catalytic activity
GO:0001217	0.428	DNA-binding transcription repressor activity
GO:0001227	0.400	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0009893	0.995	positive regulation of metabolic process
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.994	regulation of biosynthetic process
GO:0031325	0.993	positive regulation of cellular metabolic process
GO:0051252	0.993	regulation of RNA metabolic process
GO:0009987	0.985	cellular process
GO:0051173	0.980	positive regulation of nitrogen compound metabolic process
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0009891	0.978	positive regulation of biosynthetic process
GO:0010604	0.976	positive regulation of macromolecule metabolic process
GO:0045893	0.971	positive regulation of DNA-templated transcription
GO:0048519	0.915	negative regulation of biological process
GO:0051716	0.875	cellular response to stimulus
GO:0023052	0.859	signaling
GO:0007154	0.821	cell communication
GO:0048523	0.787	negative regulation of cellular process
GO:0007165	0.770	signal transduction
GO:0048583	0.515	regulation of response to stimulus
GO:0006357	0.434	regulation of transcription by RNA polymerase II
GO:0023051	0.433	regulation of signaling
GO:0010646	0.433	regulation of cell communication
GO:0009966	0.397	regulation of signal transduction
GO:0051239	0.383	regulation of multicellular organismal process
GO:0032502	0.337	developmental process
GO:0045944	0.336	positive regulation of transcription by RNA polymerase II
GO:0048856	0.334	anatomical structure development
GO:0032501	0.331	multicellular organismal process
GO:0008152	0.326	metabolic process
GO:0071704	0.316	organic substance metabolic process
GO:0009892	0.307	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0005654	0.993	nucleoplasm
GO:0032991	0.912	protein-containing complex
GO:0140513	0.348	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]