StarFunc result for job id Q13470

User Input

>input (666 residues)
MLPEAGSLWLLKLLRDIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLS
EALKRLRSGPKSKNWVYKILGGFAPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGE
LLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARG
LVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAF
SSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCW
APHPADRPSFSHLEGLLQEAGPSEACCVRDVTEPGALRMETGDPITVIEGSSSFHSPDST
IWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWD
APPARGQRRNMPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRP
PLSSSSPQPSQPSRERLPWPKRKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEVEL
SVHGVTHQECQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADCWRILEHYQWDLSAASR
YVLARP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13470	1.000	1.000	0.000	666	1.000	1.000	Q13470.pdb.gz	TNK1_HUMAN Non-receptor tyrosine-protein kinase TNK1 OS=Homo sapiens OX=9606 GN=TNK1 PE=1 SV=3
2	AFDB:Q99ML2	0.627	0.627	8.758E-90	666	0.827	0.827	Q99ML2.pdb.gz	TNK1_MOUSE Non-receptor tyrosine-protein kinase TNK1 OS=Mus musculus OX=10090 GN=Tnk1 PE=1 SV=2
3	AFDB:Q9VZI2	0.509	0.325	3.281E-42	1073	0.320	0.199	Q9VZI2.pdb.gz	ACK_DROME Activated Cdc42 kinase Ack OS=Drosophila melanogaster OX=7227 GN=Ack PE=1 SV=2
4	AFDB:Q9I7F7	0.519	0.266	3.405E-36	1337	0.260	0.129	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
5	AFDB:P08922	0.381	0.111	2.564E-24	2347	0.185	0.052	P08922.pdb.gz	ROS1_HUMAN Proto-oncogene tyrosine-protein kinase ROS OS=Homo sapiens OX=9606 GN=ROS1 PE=1 SV=3
6	AFDB:M9MM92	0.383	0.421	4.734E-24	604	0.147	0.162	M9MM92.pdb.gz
7	AFDB:F1Q9D9	0.377	0.264	1.073E-23	963	0.164	0.113	F1Q9D9.pdb.gz
8	AFDB:O08680	0.370	0.253	1.385E-23	984	0.168	0.114	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
9	AFDB:Q03526	0.372	0.396	1.981E-23	625	0.137	0.146	Q03526.pdb.gz	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
10	AFDB:P29322	0.388	0.260	4.971E-23	1005	0.162	0.107	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
11	PDB:2h8hA	0.356	0.522	7.744E-19	445	0.147	0.220	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4k2rA	0.348	0.418	8.578E-19	551	0.129	0.156	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:1k9aB	0.354	0.528	1.052E-18	441	0.134	0.202	1k9aB.pdb.gz
14	PDB:4fl2A	0.349	0.416	6.628E-18	555	0.131	0.157	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:8dksA	0.321	0.707	1.655E-15	283	0.119	0.279	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:2qkwB	0.333	0.721	9.883E-14	292	0.096	0.219	2qkwB.pdb.gz
17	PDB:6xr4A	0.307	0.203	1.152E-13	1040	0.114	0.073	6xr4A.pdb.gz
18	PDB:4btfA	0.315	0.491	1.212E-13	413	0.117	0.189	4btfA.pdb.gz
19	PDB:4zhxA	0.346	0.549	1.734E-13	409	0.092	0.149	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:4eomC	0.347	0.794	3.202E-13	276	0.111	0.268	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13470	0.0	1329	666	1.000	1.000	TNK1_HUMAN Non-receptor tyrosine-protein kinase TNK1 OS=Homo sapiens OX=9606 GN=TNK1 PE=1 SV=3
2	Q99ML2	0.0	1011	666	0.830	0.830	TNK1_MOUSE Non-receptor tyrosine-protein kinase TNK1 OS=Mus musculus OX=10090 GN=Tnk1 PE=1 SV=2
3	O54967	3.65e-117	377	1055	0.315	0.199	ACK1_MOUSE Activated CDC42 kinase 1 OS=Mus musculus OX=10090 GN=Tnk2 PE=1 SV=2
4	Q5U2X5	4.51e-117	376	1040	0.311	0.199	ACK1_RAT Activated CDC42 kinase 1 OS=Rattus norvegicus OX=10116 GN=Tnk2 PE=2 SV=1
5	A0A5F9ZHP4	1.70e-116	374	1008	0.315	0.208	A0A5F9ZHP4_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
6	A0A5F9ZI29	3.21e-116	374	1040	0.315	0.202	A0A5F9ZI29_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
7	Q07912	3.36e-116	374	1038	0.315	0.202	ACK1_HUMAN Activated CDC42 kinase 1 OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=3
8	A0A5F9ZGX5	4.69e-116	374	1055	0.315	0.199	A0A5F9ZGX5_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
9	A0A5F9ZHJ2	8.81e-116	374	1072	0.315	0.196	A0A5F9ZHJ2_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
10	Q17R13	8.85e-116	373	1039	0.314	0.201	ACK1_BOVIN Activated CDC42 kinase 1 OS=Bos taurus OX=9913 GN=TNK2 PE=1 SV=1
11	C9J1X3	9.51e-116	373	1040	0.315	0.202	C9J1X3_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
12	A0A499FJ16	1.21e-115	374	1086	0.315	0.193	A0A499FJ16_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=TNK2 PE=1 SV=1
13	Q9VZI2	1.40e-97	325	1073	0.275	0.171	ACK_DROME Activated Cdc42 kinase Ack OS=Drosophila melanogaster OX=7227 GN=Ack PE=1 SV=2
14	Q10925	2.34e-74	262	1237	0.246	0.133	SID3_CAEEL Tyrosine-protein kinase sid-3 OS=Caenorhabditis elegans OX=6239 GN=sid-3 PE=1 SV=2
15	Q9I7F7	7.45e-62	226	1337	0.236	0.117	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
16	G5EBZ8	2.06e-58	215	1043	0.245	0.156	ARK1_CAEEL Ack-related non-receptor tyrosine kinase OS=Caenorhabditis elegans OX=6239 GN=ark-1 PE=2 SV=1
17	I6L996	2.49e-52	194	680	0.158	0.154	I6L996_HUMAN PTK2 protein OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
18	H0YB16	3.93e-52	194	724	0.158	0.145	H0YB16_HUMAN Protein tyrosine kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
19	O35346	1.07e-51	195	1055	0.159	0.100	FAK1_RAT Focal adhesion kinase 1 OS=Rattus norvegicus OX=10116 GN=Ptk2 PE=1 SV=1
20	P34152	1.13e-51	195	1052	0.159	0.101	FAK1_MOUSE Focal adhesion kinase 1 OS=Mus musculus OX=10090 GN=Ptk2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	50	15.2	Phosphotransferase enzyme family
2	PF16678 HOIP-UBA	2.9e+02	12.7	HOIP UBA domain pair
3	PF14531 Kinase-like	9.5e+02	10.5	Kinase-like
4	PF00069 Pkinase	4.7e-27	106.6	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	2.9e-68	241.6	Protein tyrosine and serine/threonine kinase
6	PF14604 SH3_9	19	16.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000459799

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226279	0.647	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
2	9606.ENSP00000259883	0.606	PiggyBac transposable element-derived protein 1
3	9606.ENSP00000025301	0.600	A-kinase anchor protein 11
4	9606.ENSP00000400713	0.596	Exocyst complex component 3-like protein 2
5	9606.ENSP00000349884	0.556	Galanin-like peptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005524	1.000	ATP binding
GO:0004715	0.999	non-membrane spanning protein tyrosine kinase activity
GO:0004674	0.525	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0044238	0.984	primary metabolic process
GO:1901564	0.971	organonitrogen compound metabolic process
GO:0065007	0.967	biological regulation
GO:0050794	0.964	regulation of cellular process
GO:0006793	0.964	phosphorus metabolic process
GO:0006796	0.939	phosphate-containing compound metabolic process
GO:0019538	0.939	protein metabolic process
GO:0006468	0.930	protein phosphorylation
GO:0046777	0.916	protein autophosphorylation
GO:0048519	0.601	negative regulation of biological process
GO:0048523	0.481	negative regulation of cellular process
GO:0048583	0.448	regulation of response to stimulus
GO:0050896	0.370	response to stimulus
GO:0048518	0.363	positive regulation of biological process
GO:0048522	0.329	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0071944	0.942	cell periphery
GO:0005829	0.926	cytosol
GO:0005886	0.849	plasma membrane
GO:0043226	0.794	organelle
GO:0043227	0.729	membrane-bounded organelle
GO:0043231	0.563	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.2	0.999	non-specific protein-tyrosine kinase.

[back to server]