StarFunc result for job id Q13472

User Input

>input (1001 residues)
MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
REGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFVDIKKTLERETRQCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSE
ITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFNWKRHRLFNHTACLVLY
QLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPT
KYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDV
YPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKK
DKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYFGNGTELAQQEDIYPAMPEPIRKCPQ
CNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASRDSSVCPVCQPHPVYRLKLKF
KRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQSLNRMDNSQH
PQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNG
GSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCS
QPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES
EARSKRPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70157	0.793	0.792	0.000	1003	0.870	0.868	O70157.pdb.gz	TOP3A_MOUSE DNA topoisomerase 3-alpha OS=Mus musculus OX=10090 GN=Top3a PE=2 SV=1
2	AFDB:Q13472	1.000	1.000	0.000	1001	1.000	1.000	Q13472.pdb.gz	TOP3A_HUMAN DNA topoisomerase 3-alpha OS=Homo sapiens OX=9606 GN=TOP3A PE=1 SV=1
3	AFDB:Q9NG98	0.697	0.563	8.655E-100	1250	0.489	0.391	Q9NG98.pdb.gz	TOP3A_DROME DNA topoisomerase 3-alpha OS=Drosophila melanogaster OX=7227 GN=Top3alpha PE=2 SV=2
4	AFDB:Q9LVP1	0.602	0.650	5.631E-94	926	0.392	0.423	Q9LVP1.pdb.gz	TOP3A_ARATH DNA topoisomerase 3-alpha OS=Arabidopsis thaliana OX=3702 GN=TOP3A PE=1 SV=1
5	AFDB:O61660	0.596	0.785	3.951E-80	759	0.363	0.478	O61660.pdb.gz	TOP3_CAEEL DNA topoisomerase 3 OS=Caenorhabditis elegans OX=6239 GN=top-3 PE=1 SV=1
6	AFDB:Q383X7	0.578	0.629	3.629E-71	918	0.298	0.325	Q383X7.pdb.gz	Q383X7_TRYB2 DNA topoisomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1280 PE=3 SV=1
7	AFDB:F4ISQ7	0.580	0.670	1.137E-65	865	0.253	0.292	F4ISQ7.pdb.gz	TOP3B_ARATH DNA topoisomerase 3-beta OS=Arabidopsis thaliana OX=3702 GN=At2g32000 PE=2 SV=1
8	AFDB:O60126	0.588	0.941	1.121E-64	622	0.250	0.402	O60126.pdb.gz	TOP3_SCHPO DNA topoisomerase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=top3 PE=1 SV=2
9	AFDB:Q384B1	0.589	0.699	3.604E-64	841	0.248	0.295	Q384B1.pdb.gz	Q384B1_TRYB2 DNA topoisomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0910 PE=3 SV=1
10	PDB:4rulA	0.468	0.562	1.646E-37	823	0.174	0.211	4rulA.pdb.gz	Structural basis for suppression of hypernegative DNA supercoiling by E. coli topoisomerase I.
11	PDB:2o5cA	0.489	0.741	5.498E-33	634	0.141	0.222	2o5cA.pdb.gz	Structural Studies of E. coli Topoisomerase III-DNA Complexes Reveal a Novel Type IA Topoisomerase-DNA Conformational Intermediate.
12	PDB:2f9mA	0.085	0.381	1.934E-2	182	0.011	0.060	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
13	PDB:1kaoA	0.091	0.420	2.349E-2	167	0.010	0.060	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
14	PDB:5szjA	0.092	0.419	2.996E-2	175	0.012	0.069	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:5szhB	0.092	0.430	3.303E-2	175	0.012	0.069	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
16	AFDB:Q8IZD9	0.053	0.032	3.443E-2	2030	0.089	0.044	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
17	PDB:5ymxA	0.097	0.407	3.468E-2	202	0.016	0.079	5ymxA.pdb.gz	Allosteric regulation of a prokaryotic small Ras-like GTPase contributes to cell polarity oscillations in bacterial motility.
18	PDB:1ek9A	0.053	0.105	3.640E-2	428	0.047	0.110	1ek9A.pdb.gz
19	PDB:3t1tA	0.095	0.384	3.640E-2	193	0.020	0.104	3t1tA.pdb.gz	Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
20	PDB:3zjcF	0.081	0.251	3.640E-2	252	0.020	0.079	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O61660	0.0	647	759	0.319	0.420	TOP3_CAEEL DNA topoisomerase 3 OS=Caenorhabditis elegans OX=6239 GN=top-3 PE=1 SV=1
2	O70157	0.0	1823	1003	0.870	0.868	TOP3A_MOUSE DNA topoisomerase 3-alpha OS=Mus musculus OX=10090 GN=Top3a PE=2 SV=1
3	Q13472	0.0	2092	1001	1.000	1.000	TOP3A_HUMAN DNA topoisomerase 3-alpha OS=Homo sapiens OX=9606 GN=TOP3A PE=1 SV=1
4	Q9LVP1	0.0	738	926	0.383	0.414	TOP3A_ARATH DNA topoisomerase 3-alpha OS=Arabidopsis thaliana OX=3702 GN=TOP3A PE=1 SV=1
5	Q9NG98	0.0	790	1250	0.405	0.324	TOP3A_DROME DNA topoisomerase 3-alpha OS=Drosophila melanogaster OX=7227 GN=Top3alpha PE=2 SV=2
6	O60126	6.32e-165	499	622	0.253	0.407	TOP3_SCHPO DNA topoisomerase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=top3 PE=1 SV=2
7	P13099	1.40e-148	458	656	0.264	0.402	TOP3_YEAST DNA topoisomerase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOP3 PE=1 SV=1
8	Q9Z321	1.52e-129	415	862	0.262	0.304	TOP3B_MOUSE DNA topoisomerase 3-beta-1 OS=Mus musculus OX=10090 GN=Top3b PE=1 SV=1
9	O95985	3.05e-127	409	862	0.265	0.307	TOP3B_HUMAN DNA topoisomerase 3-beta-1 OS=Homo sapiens OX=9606 GN=TOP3B PE=1 SV=1
10	F4ISQ7	4.59e-127	409	865	0.227	0.262	TOP3B_ARATH DNA topoisomerase 3-beta OS=Arabidopsis thaliana OX=3702 GN=At2g32000 PE=2 SV=1
11	Q383X7	2.91e-123	400	918	0.239	0.260	Q383X7_TRYB2 DNA topoisomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1280 PE=3 SV=1
12	O96651	2.39e-120	391	875	0.234	0.267	TOP3B_DROME DNA topoisomerase 3-beta OS=Drosophila melanogaster OX=7227 GN=Top3beta PE=2 SV=2
13	Q384B1	8.64e-111	364	841	0.238	0.283	Q384B1_TRYB2 DNA topoisomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0910 PE=3 SV=1
14	P06612	1.87e-35	147	865	0.154	0.178	TOP1_ECOLI DNA topoisomerase 1 OS=Escherichia coli (strain K12) OX=83333 GN=topA PE=1 SV=2
15	Q9X909	3.57e-28	124	952	0.143	0.150	TOP1_STRCO DNA topoisomerase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=topA PE=3 SV=1
16	P55991	3.11e-26	118	736	0.156	0.212	TOP1_HELPY DNA topoisomerase 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=topA PE=1 SV=1
17	P14294	3.57e-22	104	653	0.154	0.236	TOP3_ECOLI DNA topoisomerase 3 OS=Escherichia coli (strain K12) OX=83333 GN=topB PE=1 SV=1
18	P9WG49	1.84e-20	100	934	0.126	0.135	TOP1_MYCTU DNA topoisomerase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=topA PE=1 SV=1
19	F4JRX3	2.71e-20	99.8	1284	0.141	0.110	F4JRX3_ARATH DNA topoisomerase OS=Arabidopsis thaliana OX=3702 GN=At4g31210 PE=1 SV=1
20	Q8K203	5.30e-09	62.4	606	0.040	0.066	NEIL3_MOUSE Endonuclease 8-like 3 OS=Mus musculus OX=10090 GN=Neil3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01131 Topoisom_bac	4.8e-110	380.1	DNA topoisomerase
2	PF01751 Toprim	1.1e-14	65.9	Toprim domain
3	PF16588 zf-C2H2_10	0.74	20.9	C2H2 zinc-finger
4	PF01396 zf-C4_Topoisom	3.8e-10	50.7	Topoisomerase DNA binding C4 zinc finger
5	PF06839 zf-GRF	1.1e-32	123.2	GRF zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442336

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308583	0.999	Centromere protein S
2	9606.ENSP00000310356	0.999	RecQ-mediated genome instability protein 2
3	9606.ENSP00000317039	0.999	RecQ-mediated genome instability protein 1
4	9606.ENSP00000347232	0.999	Bloom syndrome protein
5	9606.ENSP00000373952	0.999	Fanconi anemia group A protein
6	9606.ENSP00000267430	0.998	Fanconi anemia group M protein
7	9606.ENSP00000298139	0.997	Werner syndrome ATP-dependent helicase
8	9606.ENSP00000307853	0.997	Crossover junction endonuclease MUS81
9	9606.ENSP00000310520	0.993	DNA repair endonuclease XPF
10	9606.ENSP00000318977	0.993	Flap endonuclease GEN homolog 1
11	9606.ENSP00000333283	0.993	Fanconi anemia core complex-associated protein 100
12	9606.ENSP00000351185	0.992	DNA replication ATP-dependent helicase/nuclease DNA2
13	9606.ENSP00000372088	0.988	DNA repair protein RAD51 homolog 1
14	9606.ENSP00000376952	0.985	Crossover junction endonuclease EME1
15	9606.ENSP00000330875	0.976	Fanconi anemia group F protein
16	9606.ENSP00000367910	0.972	Fanconi anemia group G protein
17	9606.ENSP00000278616	0.971	Serine-protein kinase ATM
18	9606.ENSP00000229769	0.970	Fanconi anemia group E protein
19	9606.ENSP00000355506	0.968	Exonuclease 1
20	9606.ENSP00000353332	0.964	Regulator of telomere elongation helicase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003917	1.000	DNA topoisomerase type I (single strand cut, ATP-independent) activity
GO:0003697	1.000	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006259	0.995	DNA metabolic process
GO:0006996	0.994	organelle organization
GO:0006302	0.992	double-strand break repair
GO:0000725	0.981	recombinational repair
GO:0000724	0.957	double-strand break repair via homologous recombination
GO:0000002	0.914	mitochondrial genome maintenance
GO:0051276	0.905	chromosome organization
GO:0022402	0.869	cell cycle process
GO:0007059	0.861	chromosome segregation
GO:0000003	0.840	reproduction
GO:0071103	0.805	DNA conformation change
GO:0051321	0.782	meiotic cell cycle
GO:0051304	0.734	chromosome separation
GO:0032042	0.678	mitochondrial DNA metabolic process
GO:0006265	0.672	DNA topological change
GO:0065007	0.533	biological regulation
GO:0050789	0.379	regulation of biological process
GO:0050794	0.339	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0032991	0.964	protein-containing complex
GO:0005694	0.872	chromosome
GO:1902494	0.766	catalytic complex
GO:0016604	0.733	nuclear body
GO:0005737	0.512	cytoplasm
GO:0016605	0.424	PML body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.1	1.000	DNA topoisomerase.

[back to server]