StarFunc result for job id Q13478

User Input

>input (541 residues)
MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13478	1.000	1.000	0.000	541	1.000	1.000	Q13478.pdb.gz	IL18R_HUMAN Interleukin-18 receptor 1 OS=Homo sapiens OX=9606 GN=IL18R1 PE=1 SV=1
2	AFDB:Q61098	0.480	0.483	7.731E-81	537	0.638	0.642	Q61098.pdb.gz	IL18R_MOUSE Interleukin-18 receptor 1 OS=Mus musculus OX=10090 GN=Il18r1 PE=1 SV=1
3	AFDB:P13504	0.425	0.402	8.830E-48	576	0.266	0.250	P13504.pdb.gz	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
4	AFDB:Q02955	0.443	0.421	3.219E-46	576	0.268	0.252	Q02955.pdb.gz	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
5	AFDB:Q90874	0.510	0.500	4.897E-46	555	0.266	0.259	Q90874.pdb.gz	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
6	AFDB:Q61730	0.367	0.352	9.468E-46	570	0.281	0.267	Q61730.pdb.gz	IL1AP_MOUSE Interleukin-1 receptor accessory protein OS=Mus musculus OX=10090 GN=Il1rap PE=1 SV=1
7	AFDB:Q9NP60	0.420	0.350	6.070E-45	686	0.325	0.257	Q9NP60.pdb.gz	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
8	AFDB:Q9NPH3	0.419	0.402	1.041E-44	570	0.290	0.275	Q9NPH3.pdb.gz	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
9	AFDB:B6ZK77	0.378	0.307	2.558E-44	700	0.288	0.223	B6ZK77.pdb.gz	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
10	AFDB:P14719	0.471	0.453	9.562E-44	567	0.275	0.263	P14719.pdb.gz	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
11	PDB:6dldD	0.142	0.260	3.793E-12	269	0.083	0.167	6dldD.pdb.gz
12	PDB:2rcjC	0.148	0.152	1.227E-10	523	0.078	0.080	2rcjC.pdb.gz
13	PDB:1e07A	0.149	0.129	8.350E-10	642	0.105	0.089	1e07A.pdb.gz
14	PDB:5oj2B	0.139	0.112	1.820E-9	692	0.102	0.079	5oj2B.pdb.gz
15	PDB:1ngwH	0.159	0.357	1.483E-8	216	0.059	0.148	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
16	PDB:6dlfA	0.123	0.254	2.001E-8	236	0.076	0.174	6dlfA.pdb.gz
17	PDB:4r2gP	0.145	0.350	2.867E-8	210	0.065	0.167	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
18	PDB:3o3uN	0.187	0.176	3.044E-8	580	0.057	0.053	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
19	PDB:2ig2H	0.161	0.285	8.954E-8	238	0.048	0.109	2ig2H.pdb.gz
20	PDB:1jnhA	0.152	0.340	1.009E-7	208	0.052	0.135	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13478	0.0	1117	541	1.000	1.000	IL18R_HUMAN Interleukin-18 receptor 1 OS=Homo sapiens OX=9606 GN=IL18R1 PE=1 SV=1
2	Q61098	0.0	687	537	0.643	0.648	IL18R_MOUSE Interleukin-18 receptor 1 OS=Mus musculus OX=10090 GN=Il18r1 PE=1 SV=1
3	Q9NZN1	3.68e-52	191	696	0.316	0.246	IRPL1_HUMAN Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens OX=9606 GN=IL1RAPL1 PE=1 SV=2
4	Q9NP60	1.18e-51	189	686	0.314	0.248	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
5	P59824	3.96e-51	188	696	0.314	0.244	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
6	P14778	5.42e-51	185	569	0.288	0.274	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
7	P59823	2.72e-49	182	695	0.316	0.246	IRPL1_MOUSE Interleukin-1 receptor accessory protein-like 1 OS=Mus musculus OX=10090 GN=Il1rapl1 PE=1 SV=1
8	B6ZK77	6.97e-49	182	700	0.285	0.220	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
9	Q9NPH3	1.03e-48	179	570	0.311	0.295	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
10	P13504	2.67e-48	178	576	0.274	0.257	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
11	Q9Z2B1	5.17e-48	178	614	0.237	0.208	I18RA_MOUSE Interleukin-18 receptor accessory protein OS=Mus musculus OX=10090 GN=Il18rap PE=2 SV=1
12	P14719	6.03e-48	177	567	0.275	0.263	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
13	A0A0G2K2K7	2.60e-47	176	627	0.235	0.203	A0A0G2K2K7_RAT Interleukin 18 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Il18rap PE=3 SV=1
14	Q01638	2.06e-46	172	556	0.262	0.255	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
15	Q63621	4.97e-46	172	570	0.305	0.289	IL1AP_RAT Interleukin-1 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Il1rap PE=2 SV=1
16	Q61730	1.10e-45	171	570	0.318	0.302	IL1AP_MOUSE Interleukin-1 receptor accessory protein OS=Mus musculus OX=10090 GN=Il1rap PE=1 SV=1
17	O95256	2.34e-45	170	599	0.262	0.237	I18RA_HUMAN Interleukin-18 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL18RAP PE=1 SV=1
18	Q02955	3.10e-45	169	576	0.279	0.262	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
19	Q62611	3.44e-44	166	566	0.262	0.251	ILRL1_RAT Interleukin-1 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rl1 PE=2 SV=1
20	Q90874	1.92e-42	161	555	0.261	0.254	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	6.8e-05	34.2	Immunoglobulin I-set domain
2	PF00047 ig	1.9	20.0	Immunoglobulin domain
3	PF13895 Ig_2	3.4e-07	41.8	Immunoglobulin domain
4	PF13927 Ig_3	1e-05	37.3	Immunoglobulin domain
5	PF16681 Ig_5	44	15.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
6	PF18452 Ig_6	0.14	23.5	Immunoglobulin domain
7	PF01582 TIR	4.6e-38	142.3	TIR domain
8	PF13676 TIR_2	1.4e-06	40.3	TIR domain
9	PF07686 V-set	3.8e-08	44.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280357	0.999	Interleukin-18
2	9606.ENSP00000263326	0.992	Interleukin-37
3	9606.ENSP00000264260	0.992	Interleukin-18 receptor accessory protein
4	9606.ENSP00000384212	0.957	Interleukin-18-binding protein
5	9606.ENSP00000376134	0.948	Signal transducer and activator of transcription 4
6	9606.ENSP00000264657	0.929	Signal transducer and activator of transcription 3
7	9606.ENSP00000226574	0.919	Nuclear factor NF-kappa-B p105 subunit
8	9606.ENSP00000360266	0.915	Transcription factor AP-1
9	9606.ENSP00000384273	0.911	Transcription factor p65
10	9606.ENSP00000306894	0.905	ETS translocation variant 5
11	9606.ENSP00000378974	0.902	Mitogen-activated protein kinase 8
12	9606.ENSP00000329967	0.901	Serine/threonine-protein kinase TBK1
13	9606.ENSP00000394560	0.901	Mitogen-activated protein kinase 9
14	9606.ENSP00000370842	0.807	Interleukin-33
15	9606.ENSP00000403104	0.712	Single Ig IL-1-related receptor
16	9606.ENSP00000314976	0.690	Interleukin-20 receptor subunit alpha
17	9606.ENSP00000264709	0.660	DNA (cytosine-5)-methyltransferase 3A
18	9606.ENSP00000377724	0.653	ORM1-like protein 3
19	9606.ENSP00000415049	0.653	Gasdermin-B
20	9606.ENSP00000262345	0.620	Interleukin-12 receptor subunit beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0004896	1.000	cytokine receptor activity
GO:0005102	0.735	signaling receptor binding
GO:0042802	0.374	identical protein binding
GO:0042008	0.331	interleukin-18 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.992	positive regulation of biological process
GO:0010468	0.990	regulation of gene expression
GO:0007165	0.990	signal transduction
GO:0048583	0.976	regulation of response to stimulus
GO:0002376	0.970	immune system process
GO:0009893	0.965	positive regulation of metabolic process
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0031323	0.948	regulation of cellular metabolic process
GO:0001817	0.945	regulation of cytokine production
GO:0019221	0.941	cytokine-mediated signaling pathway
GO:0051171	0.938	regulation of nitrogen compound metabolic process
GO:0001819	0.930	positive regulation of cytokine production
GO:0048584	0.912	positive regulation of response to stimulus
GO:0009889	0.910	regulation of biosynthetic process
GO:0002682	0.906	regulation of immune system process
GO:0006955	0.904	immune response
GO:0002684	0.902	positive regulation of immune system process
GO:0031326	0.893	regulation of cellular biosynthetic process
GO:0080090	0.888	regulation of primary metabolic process
GO:0050778	0.871	positive regulation of immune response
GO:0051090	0.849	regulation of DNA-binding transcription factor activity
GO:0032649	0.821	regulation of type II interferon production
GO:0048522	0.799	positive regulation of cellular process
GO:0002720	0.793	positive regulation of cytokine production involved in immune response
GO:0032729	0.771	positive regulation of type II interferon production
GO:0044093	0.767	positive regulation of molecular function
GO:0051091	0.738	positive regulation of DNA-binding transcription factor activity
GO:0051092	0.730	positive regulation of NF-kappaB transcription factor activity
GO:0002819	0.568	regulation of adaptive immune response
GO:0002703	0.489	regulation of leukocyte mediated immunity
GO:0006950	0.399	response to stress
GO:0009966	0.348	regulation of signal transduction
GO:0048519	0.334	negative regulation of biological process
GO:0031325	0.321	positive regulation of cellular metabolic process
GO:0051173	0.313	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.990	protein-containing complex
GO:0005622	0.926	intracellular anatomical structure
GO:0043235	0.849	receptor complex
GO:0098796	0.781	membrane protein complex
GO:0098797	0.747	plasma membrane protein complex
GO:0005737	0.726	cytoplasm
GO:0098802	0.707	plasma membrane signaling receptor complex
GO:0043229	0.688	intracellular organelle
GO:0005829	0.658	cytosol
GO:0043231	0.592	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]