StarFunc result for job id Q13480

User Input

>input (694 residues)
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQM
IYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLP
EWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED
PNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYV
VVDQQKTLALKSTREAWTDGRQSTESETPAKSVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QYY0	0.374	0.373	1.081E-79	695	0.903	0.902	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
2	AFDB:D3ZAL7	0.235	0.235	4.762E-76	693	0.889	0.890	D3ZAL7.pdb.gz	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
3	AFDB:C6JUQ2	0.214	0.207	4.617E-72	721	0.888	0.854	C6JUQ2.pdb.gz	C6JUQ2_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=1
4	AFDB:F1Q7S5	0.295	0.280	4.077E-56	740	0.641	0.601	F1Q7S5.pdb.gz	F1Q7S5_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=1
5	AFDB:F6NTT0	0.247	0.242	5.753E-55	712	0.647	0.631	F6NTT0.pdb.gz	F6NTT0_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=2
6	AFDB:Q9UQC2	0.223	0.229	1.509E-35	676	0.406	0.417	Q9UQC2.pdb.gz	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
7	AFDB:Q8BSM5	0.174	0.201	1.857E-20	595	0.265	0.309	Q8BSM5.pdb.gz	GAB3_MOUSE GRB2-associated-binding protein 3 OS=Mus musculus OX=10090 GN=Gab3 PE=1 SV=1
8	PDB:3ljuX	0.137	0.249	2.060E-5	373	0.027	0.051	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
9	PDB:4mk0A	0.128	0.140	3.420E-5	631	0.033	0.036	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
10	PDB:6u3eA	0.111	0.189	1.055E-4	397	0.037	0.065	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
11	PDB:4iapA	0.098	0.251	1.321E-4	256	0.035	0.094	4iapA.pdb.gz
12	AFDB:Q9DF49	0.142	0.096	1.385E-4	1074	0.228	0.147	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
13	PDB:6bbpA	0.113	0.150	1.479E-4	520	0.037	0.050	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	AFDB:A8DZ20	0.127	0.092	1.942E-4	973	0.143	0.102	A8DZ20.pdb.gz	A8DZ20_DROME Rho-type guanine nucleotide exchange factor, isoform D OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
15	AFDB:F1MAL5	0.131	0.070	2.574E-4	1327	0.179	0.093	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
16	PDB:3pvuA	0.123	0.139	2.597E-4	609	0.033	0.038	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:7c3mA	0.120	0.143	5.105E-4	577	0.029	0.035	7c3mA.pdb.gz
18	PDB:3uzsA	0.129	0.146	1.188E-3	609	0.030	0.034	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:6s9wA	0.114	0.184	1.488E-3	411	0.032	0.054	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:7rx9A	0.124	0.195	2.087E-3	432	0.030	0.049	7rx9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C6JUQ2	0.0	1199	721	0.889	0.856	C6JUQ2_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=1
2	D3ZAL7	0.0	1200	724	0.890	0.854	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
3	F1Q7S5	0.0	822	740	0.643	0.603	F1Q7S5_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=1
4	F6NTT0	0.0	835	712	0.641	0.625	F6NTT0_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=2
5	Q13480	0.0	1418	694	1.000	1.000	GAB1_HUMAN GRB2-associated-binding protein 1 OS=Homo sapiens OX=9606 GN=GAB1 PE=1 SV=2
6	Q9QYY0	0.0	1204	695	0.903	0.902	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
7	Q9UQC2	2.93e-128	397	676	0.414	0.425	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
8	Q9Z1S8	4.87e-125	388	665	0.422	0.441	GAB2_MOUSE GRB2-associated-binding protein 2 OS=Mus musculus OX=10090 GN=Gab2 PE=1 SV=2
9	Q9EQH1	1.54e-124	387	665	0.419	0.438	GAB2_RAT GRB2-associated-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Gab2 PE=1 SV=2
10	Q8BSM5	1.45e-42	165	595	0.118	0.138	GAB3_MOUSE GRB2-associated-binding protein 3 OS=Mus musculus OX=10090 GN=Gab3 PE=1 SV=1
11	Q9VZZ9	5.14e-21	100	878	0.071	0.056	DOS_DROME Protein daughter of sevenless OS=Drosophila melanogaster OX=7227 GN=dos PE=1 SV=1
12	Q9HB21	2.38e-07	55.8	404	0.045	0.077	PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2
13	Q8BUL6	5.76e-07	54.7	383	0.045	0.081	PKHA1_MOUSE Pleckstrin homology domain-containing family A member 1 OS=Mus musculus OX=10090 GN=Plekha1 PE=1 SV=1
14	Q5RGS4	6.93e-07	54.3	383	0.045	0.081	Q5RGS4_HUMAN Pleckstrin homology domain containing A1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=1
15	Q00IB7	1.07e-06	54.7	1433	0.049	0.024	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
16	P81122	1.16e-06	54.7	1321	0.052	0.027	IRS2_MOUSE Insulin receptor substrate 2 OS=Mus musculus OX=10090 GN=Irs2 PE=1 SV=2
17	Q9Y4H2	1.69e-06	53.9	1338	0.052	0.027	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
18	P35569	1.84e-06	53.9	1233	0.048	0.027	IRS1_MOUSE Insulin receptor substrate 1 OS=Mus musculus OX=10090 GN=Irs1 PE=1 SV=1
19	P35568	2.01e-06	53.9	1242	0.048	0.027	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
20	P35570	2.08e-06	53.9	1235	0.048	0.027	IRS1_RAT Insulin receptor substrate 1 OS=Rattus norvegicus OX=10116 GN=Irs1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	1.9e-18	78.3	PH domain
2	PF15413 PH_11	0.0064	28.3	Pleckstrin homology domain
3	PF16652 PH_13	3.2e+02	12.6	Pleckstrin homology domain
4	PF08458 PH_2	6.7e+02	12.0	Plant pleckstrin homology-like region
5	PF14593 PH_3	1.7e+02	13.6	PH domain
6	PF15409 PH_8	1.6e+02	13.9	Pleckstrin homology domain
7	PF15410 PH_9	3.1e+02	13.0	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262995

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
3	9606.ENSP00000275493	0.998	Epidermal growth factor receptor
4	9606.ENSP00000317272	0.998	Hepatocyte growth factor receptor
5	9606.ENSP00000401303	0.997	SHC-transforming protein 1
6	9606.ENSP00000300574	0.993	Adapter molecule crk
7	9606.ENSP00000346300	0.993	Crk-like protein
8	9606.ENSP00000428056	0.993	Phosphatidylinositol 3-kinase regulatory subunit alpha
9	9606.ENSP00000244007	0.986	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
10	9606.ENSP00000447241	0.981	Fibroblast growth factor receptor substrate 2
11	9606.ENSP00000387784	0.980	Son of sevenless homolog 1
12	9606.ENSP00000362680	0.972	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000451828	0.965	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000222390	0.959	Hepatocyte growth factor
15	9606.ENSP00000431418	0.959	High affinity nerve growth factor receptor
16	9606.ENSP00000347942	0.957	Proto-oncogene tyrosine-protein kinase receptor Ret
17	9606.ENSP00000469413	0.953	Serine/threonine-protein kinase PAK 4
18	9606.ENSP00000263025	0.952	Mitogen-activated protein kinase 3
19	9606.ENSP00000277120	0.949	BDNF/NT-3 growth factors receptor
20	9606.ENSP00000215832	0.947	Mitogen-activated protein kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0070848	0.993	response to growth factor
GO:0009987	0.956	cellular process
GO:0050794	0.939	regulation of cellular process
GO:0051716	0.886	cellular response to stimulus
GO:0007165	0.881	signal transduction
GO:0048518	0.840	positive regulation of biological process
GO:0071363	0.839	cellular response to growth factor stimulus
GO:0007166	0.720	cell surface receptor signaling pathway
GO:0032502	0.712	developmental process
GO:0048856	0.688	anatomical structure development
GO:0048522	0.658	positive regulation of cellular process
GO:0007167	0.569	enzyme-linked receptor protein signaling pathway
GO:0007169	0.560	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0042221	0.451	response to chemical
GO:0070887	0.404	cellular response to chemical stimulus
GO:0019222	0.373	regulation of metabolic process
GO:0032501	0.365	multicellular organismal process
GO:0048583	0.359	regulation of response to stimulus
GO:0060255	0.312	regulation of macromolecule metabolic process
GO:0031323	0.312	regulation of cellular metabolic process
GO:0080090	0.306	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.925	plasma membrane
GO:0030054	0.868	cell junction
GO:0043231	0.781	intracellular membrane-bounded organelle
GO:0070161	0.507	anchoring junction
GO:0005911	0.323	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]