StarFunc result for job id Q13485

User Input

>input (552 residues)
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R274	0.544	0.544	2.829E-102	552	1.000	1.000	A0A024R274.pdb.gz	A0A024R274_HUMAN Mothers against decapentaplegic homolog (Fragment) OS=Homo sapiens OX=9606 GN=SMAD4 PE=2 SV=1
2	AFDB:B1PS58	0.514	0.518	6.758E-87	547	0.880	0.888	B1PS58.pdb.gz	B1PS58_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=zmp:0000000768 PE=1 SV=1
3	AFDB:B1PS59	0.545	0.588	1.964E-83	505	0.833	0.911	B1PS59.pdb.gz	B1PS59_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh4 PE=1 SV=1
4	AFDB:K7EIU8	0.458	0.535	3.417E-82	456	0.824	0.998	K7EIU8.pdb.gz	K7EIU8_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=SMAD4 PE=1 SV=1
5	AFDB:O77069	0.587	0.475	1.486E-69	697	0.670	0.531	O77069.pdb.gz	O77069_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Med PE=2 SV=1
6	AFDB:O62609	0.675	0.488	1.344E-68	771	0.656	0.470	O62609.pdb.gz	O62609_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Med PE=2 SV=1
7	AFDB:P45897	0.424	0.413	2.918E-42	570	0.371	0.360	P45897.pdb.gz	SMA4_CAEEL Dwarfin sma-4 OS=Caenorhabditis elegans OX=6239 GN=sma-4 PE=2 SV=1
8	AFDB:P97588	0.317	0.370	1.365E-38	468	0.335	0.395	P97588.pdb.gz	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
9	AFDB:Q9Z7J3	0.111	0.074	5.400E-2	845	0.085	0.056	Q9Z7J3.pdb.gz	Q9Z7J3_CHLPN Adenylate cyclase-like protein OS=Chlamydia pneumoniae OX=83558 GN=CP_0034 PE=1 SV=1
10	PDB:7dvqX	0.123	0.376	6.030E-2	156	0.020	0.071	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
11	PDB:2kb3A	0.100	0.314	1.563E-1	143	0.031	0.119	2kb3A.pdb.gz
12	AFDB:F1RD88	0.118	0.088	5.183E-1	775	0.053	0.037	F1RD88.pdb.gz
13	PDB:5fb5B	0.063	0.060	5.787E-1	576	0.040	0.038	5fb5B.pdb.gz
14	PDB:3dtfA	0.078	0.105	1.049	363	0.031	0.047	3dtfA.pdb.gz	Structural analysis of mycobacterial branched-chain aminotransferase: implications for inhibitor design.
15	PDB:5xqiB	0.090	0.151	1.049	276	0.043	0.087	5xqiB.pdb.gz
16	PDB:7u05A	0.055	0.029	1.182	1114	0.018	0.009	7u05A.pdb.gz
17	PDB:7u7nC	0.059	0.139	1.793	200	0.043	0.120	7u7nC.pdb.gz
18	PDB:1grjA	0.046	0.124	2.275	151	0.018	0.066	1grjA.pdb.gz
19	PDB:4v60A	0.066	0.050	2.414	812	0.025	0.017	4v60A.pdb.gz
20	PDB:6j6gC	0.056	0.038	2.562	920	0.022	0.013	6j6gC.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R274	0.0	1151	552	1.000	1.000	A0A024R274_HUMAN Mothers against decapentaplegic homolog (Fragment) OS=Homo sapiens OX=9606 GN=SMAD4 PE=2 SV=1
2	B1PS58	0.0	909	547	0.875	0.883	B1PS58_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=zmp:0000000768 PE=1 SV=1
3	B1PS59	0.0	843	505	0.828	0.905	B1PS59_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh4 PE=1 SV=1
4	O70437	0.0	1137	552	0.987	0.987	SMAD4_RAT Mothers against decapentaplegic homolog 4 OS=Rattus norvegicus OX=10116 GN=Smad4 PE=1 SV=1
5	P97471	0.0	1132	551	0.984	0.985	SMAD4_MOUSE Mothers against decapentaplegic homolog 4 OS=Mus musculus OX=10090 GN=Smad4 PE=1 SV=2
6	Q13485	0.0	1151	552	1.000	1.000	SMAD4_HUMAN Mothers against decapentaplegic homolog 4 OS=Homo sapiens OX=9606 GN=SMAD4 PE=1 SV=1
7	K7EIU8	7.79e-171	493	456	0.422	0.511	K7EIU8_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=SMAD4 PE=1 SV=1
8	O77069	2.92e-116	361	697	0.361	0.286	O77069_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Med PE=2 SV=1
9	Q8IMG6	4.43e-116	361	697	0.361	0.286	Q8IMG6_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Med PE=3 SV=1
10	Q7KPL1	2.55e-115	360	745	0.361	0.267	Q7KPL1_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Med PE=2 SV=1
11	O62609	6.44e-115	360	771	0.361	0.258	O62609_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Med PE=2 SV=1
12	O76259	6.44e-115	360	771	0.361	0.258	O76259_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Med PE=3 SV=1
13	O61458	6.95e-115	359	745	0.359	0.266	O61458_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Med PE=2 SV=1
14	Q9U010	1.21e-94	305	682	0.272	0.220	Q9U010_DROME Mothers against decapentaplegic homolog (Fragment) OS=Drosophila melanogaster OX=7227 GN=Med PE=2 SV=1
15	O15198	3.06e-78	256	467	0.348	0.411	SMAD9_HUMAN Mothers against decapentaplegic homolog 9 OS=Homo sapiens OX=9606 GN=SMAD9 PE=1 SV=1
16	Q9I8V2	1.98e-76	251	472	0.342	0.400	SMAD1_DANRE Mothers against decapentaplegic homolog 1 OS=Danio rerio OX=7955 GN=smad1 PE=2 SV=1
17	Q15797	4.17e-76	250	465	0.344	0.409	SMAD1_HUMAN Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1
18	P70340	2.65e-75	248	465	0.342	0.406	SMAD1_MOUSE Mothers against decapentaplegic homolog 1 OS=Mus musculus OX=10090 GN=Smad1 PE=1 SV=2
19	Q8AY15	1.12e-53	189	425	0.310	0.402	Q8AY15_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh3 PE=2 SV=1
20	P45897	1.32e-49	182	570	0.161	0.156	SMA4_CAEEL Dwarfin sma-4 OS=Caenorhabditis elegans OX=6239 GN=sma-4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10401 IRF-3	4.5e+02	12.0	Interferon-regulatory factor 3
2	PF03165 MH1	2e-36	135.7	MH1 domain
3	PF03166 MH2	1.2e-71	252.1	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000014415

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013966	0.999	Mothers against decapentaplegic homolog
2	61853.ENSNLEP00000015776	0.999	Mothers against decapentaplegic homolog
3	61853.ENSNLEP00000000224	0.996	Uncharacterized protein
4	61853.ENSNLEP00000006363	0.992	SKI-like proto-oncogene
5	61853.ENSNLEP00000006702	0.991	Mothers against decapentaplegic homolog
6	61853.ENSNLEP00000020704	0.985	Receptor protein serine/threonine kinase
7	61853.ENSNLEP00000002004	0.984	Mothers against decapentaplegic homolog
8	61853.ENSNLEP00000005036	0.980	TGF-beta receptor type-2
9	61853.ENSNLEP00000018748	0.978	E1A binding protein p300
10	61853.ENSNLEP00000010252	0.972	Mothers against decapentaplegic homolog
11	61853.ENSNLEP00000005733	0.969	Tripartite motif containing 33
12	61853.ENSNLEP00000003745	0.948	WW domain containing transcription regulator 1
13	61853.ENSNLEP00000011912	0.936	CREB binding protein
14	61853.ENSNLEP00000005266	0.935	E2F transcription factor 4, p107/p130-binding
15	61853.ENSNLEP00000014024	0.935	Mothers against decapentaplegic homolog
16	61853.ENSNLEP00000017108	0.935	Bone morphogenetic protein 2
17	61853.ENSNLEP00000007536	0.934	RB transcriptional corepressor like 1
18	61853.ENSNLEP00000008726	0.929	Yes-associated protein 1
19	61853.ENSNLEP00000021481	0.926	Sp1 transcription factor
20	61853.ENSNLEP00000013159	0.925	Forkhead box H1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0140110	0.878	transcription regulator activity
GO:0003700	0.656	DNA-binding transcription factor activity
GO:0000977	0.476	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.369	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.988	multicellular organismal process
GO:0048856	0.988	anatomical structure development
GO:0050896	0.986	response to stimulus
GO:0009987	0.983	cellular process
GO:0080090	0.978	regulation of primary metabolic process
GO:0048522	0.977	positive regulation of cellular process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0007154	0.974	cell communication
GO:0023052	0.973	signaling
GO:0048513	0.965	animal organ development
GO:0007275	0.962	multicellular organism development
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0048519	0.949	negative regulation of biological process
GO:0007165	0.931	signal transduction
GO:0042221	0.920	response to chemical
GO:0010468	0.917	regulation of gene expression
GO:0071363	0.910	cellular response to growth factor stimulus
GO:0007178	0.908	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051239	0.905	regulation of multicellular organismal process
GO:0031323	0.905	regulation of cellular metabolic process
GO:0048731	0.873	system development
GO:0048523	0.870	negative regulation of cellular process
GO:0009893	0.864	positive regulation of metabolic process
GO:0010605	0.855	negative regulation of macromolecule metabolic process
GO:0019219	0.843	regulation of nucleobase-containing compound metabolic process
GO:0009888	0.832	tissue development
GO:0007548	0.822	sex differentiation
GO:0010604	0.814	positive regulation of macromolecule metabolic process
GO:0009889	0.813	regulation of biosynthetic process
GO:0051173	0.809	positive regulation of nitrogen compound metabolic process
GO:0051252	0.805	regulation of RNA metabolic process
GO:0006355	0.796	regulation of DNA-templated transcription
GO:0009653	0.784	anatomical structure morphogenesis
GO:0031325	0.779	positive regulation of cellular metabolic process
GO:0048583	0.775	regulation of response to stimulus
GO:0048729	0.752	tissue morphogenesis
GO:0051172	0.742	negative regulation of nitrogen compound metabolic process
GO:0008152	0.725	metabolic process
GO:0048869	0.692	cellular developmental process
GO:0009966	0.685	regulation of signal transduction
GO:0071704	0.611	organic substance metabolic process
GO:0044238	0.601	primary metabolic process
GO:0044237	0.583	cellular metabolic process
GO:0045935	0.565	positive regulation of nucleobase-containing compound metabolic process
GO:0061458	0.564	reproductive system development
GO:0006807	0.563	nitrogen compound metabolic process
GO:0050793	0.535	regulation of developmental process
GO:0009891	0.535	positive regulation of biosynthetic process
GO:0031328	0.526	positive regulation of cellular biosynthetic process
GO:0048262	0.523	determination of dorsal/ventral asymmetry
GO:0031324	0.513	negative regulation of cellular metabolic process
GO:0045893	0.513	positive regulation of DNA-templated transcription
GO:0006357	0.511	regulation of transcription by RNA polymerase II
GO:0007507	0.509	heart development
GO:0043170	0.505	macromolecule metabolic process
GO:0030154	0.500	cell differentiation
GO:0048738	0.479	cardiac muscle tissue development
GO:0060429	0.473	epithelium development
GO:0048584	0.470	positive regulation of response to stimulus
GO:0010033	0.423	response to organic substance
GO:0051246	0.418	regulation of protein metabolic process
GO:0009967	0.413	positive regulation of signal transduction
GO:0002009	0.410	morphogenesis of an epithelium
GO:0061061	0.399	muscle structure development
GO:0045944	0.395	positive regulation of transcription by RNA polymerase II
GO:0007517	0.388	muscle organ development
GO:0071560	0.377	cellular response to transforming growth factor beta stimulus
GO:0090092	0.368	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007179	0.328	transforming growth factor beta receptor signaling pathway
GO:0009890	0.326	negative regulation of biosynthetic process
GO:0031327	0.319	negative regulation of cellular biosynthetic process
GO:0042127	0.317	regulation of cell population proliferation
GO:0010558	0.317	negative regulation of macromolecule biosynthetic process
GO:0051253	0.315	negative regulation of RNA metabolic process
GO:0060026	0.313	convergent extension
GO:0006950	0.306	response to stress
GO:0045892	0.304	negative regulation of DNA-templated transcription
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0005829	0.972	cytosol
GO:0140513	0.693	nuclear protein-containing complex
GO:0005667	0.501	transcription regulator complex
GO:0005856	0.416	cytoskeleton
GO:0090575	0.386	RNA polymerase II transcription regulator complex
GO:0015630	0.329	microtubule cytoskeleton
GO:0071141	0.315	SMAD protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]