StarFunc result for job id Q13489

User Input

>input (604 residues)
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13489	1.000	1.000	2.046E-97	604	1.000	1.000	Q13489.pdb.gz	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
2	AFDB:A0A669KBC7	0.555	0.524	3.009E-85	645	1.000	0.936	A0A669KBC7.pdb.gz	A0A669KBC7_HUMAN Baculoviral IAP repeat containing 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=1
3	AFDB:Q13490	0.644	0.630	1.956E-73	618	0.722	0.706	Q13490.pdb.gz	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
4	AFDB:F7FLN8	0.464	0.444	2.269E-72	638	0.738	0.699	F7FLN8.pdb.gz	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
5	AFDB:Q62210	0.612	0.605	5.135E-72	612	0.697	0.688	Q62210.pdb.gz	BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Birc2 PE=1 SV=1
6	AFDB:O08863	0.460	0.463	1.280E-71	600	0.735	0.740	O08863.pdb.gz	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
7	AFDB:Q90660	0.541	0.535	1.821E-67	611	0.680	0.673	Q90660.pdb.gz	BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus OX=9031 GN=ITA PE=2 SV=1
8	AFDB:H0YZU0	0.170	0.206	6.942E-34	485	0.336	0.419	H0YZU0.pdb.gz	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
9	AFDB:Q60989	0.175	0.208	8.413E-34	496	0.339	0.413	Q60989.pdb.gz	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
10	AFDB:P98170	0.163	0.195	5.481E-33	497	0.333	0.404	P98170.pdb.gz	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
11	PDB:6b5bA	0.140	0.073	1.017E-10	1199	0.161	0.081	6b5bA.pdb.gz
12	PDB:5yudA	0.139	0.070	8.094E-8	1238	0.113	0.055	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
13	PDB:1m4mA	0.114	0.586	4.850E-4	112	0.045	0.241	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
14	PDB:3uedC	0.115	0.470	6.790E-4	139	0.041	0.180	3uedC.pdb.gz	Molecular basis for phosphospecific recognition of histone H3 tails by Survivin paralogues at inner centromeres.
15	PDB:6mksA	0.130	0.832	5.626E-3	90	0.041	0.278	6mksA.pdb.gz
16	PDB:4ikmA	0.141	0.184	6.498E-3	463	0.043	0.056	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
17	PDB:4irlB	0.128	0.165	3.173E-2	463	0.041	0.054	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
18	PDB:6ki0A	0.128	0.166	6.846E-2	459	0.033	0.044	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
19	PDB:5juyB	0.137	0.069	9.584E-2	1234	0.035	0.017	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
20	PDB:1dgnA	0.131	0.803	1.219E-1	89	0.036	0.247	1dgnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTI9	0.0	946	638	0.740	0.701	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
2	A0A669KBC7	0.0	1244	645	1.000	0.936	A0A669KBC7_HUMAN Baculoviral IAP repeat containing 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=1
3	A0A8I6ADV9	0.0	745	537	0.613	0.689	A0A8I6ADV9_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=4 SV=1
4	F7FLN8	0.0	927	602	0.733	0.736	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
5	O08863	0.0	938	600	0.737	0.742	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
6	Q13489	0.0	1266	604	1.000	1.000	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
7	Q13490	0.0	885	618	0.728	0.712	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
8	Q5XIW4	0.0	946	602	0.740	0.743	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
9	Q62210	0.0	857	612	0.704	0.694	BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Birc2 PE=1 SV=1
10	Q6P6S1	0.0	867	589	0.707	0.725	Q6P6S1_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=3 SV=1
11	Q90660	0.0	824	611	0.677	0.669	BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus OX=9031 GN=ITA PE=2 SV=1
12	P98170	1.21e-88	285	497	0.278	0.338	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
13	Q60989	7.52e-86	278	496	0.268	0.327	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
14	A5D8Q0	2.09e-85	276	488	0.262	0.324	XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2
15	H0YZU0	1.24e-84	274	485	0.267	0.332	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
16	Q9R0I6	8.94e-84	273	496	0.258	0.315	XIAP_RAT E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus OX=10116 GN=Xiap PE=2 SV=1
17	Q24307	1.02e-79	262	498	0.286	0.347	DIAP2_DROME Death-associated inhibitor of apoptosis 2 OS=Drosophila melanogaster OX=7227 GN=Diap2 PE=1 SV=3
18	Q8JHV9	1.25e-70	235	401	0.220	0.332	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
19	P41437	1.31e-51	180	268	0.127	0.287	IAP3_NPVOP E3 ubiquitin-protein ligase IAP-3 OS=Orgyia pseudotsugata multicapsid polyhedrosis virus OX=262177 GN=IAP3 PE=3 SV=1
20	Q9R016	3.63e-42	166	1403	0.182	0.078	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e OS=Mus musculus OX=10090 GN=Naip5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00653 BIR	4e-60	211.7	Inhibitor of Apoptosis domain
2	PF00619 CARD	7.9e-17	72.4	Caspase recruitment domain
3	PF10217 DUF2039	3.6e+02	12.9	Uncharacterized conserved protein (DUF2039)
4	PF14447 Prok-RING_4	4.8e-05	34.5	Prokaryotic RING finger family 4
5	PF13923 zf-C3HC4_2	3.9e+02	12.3	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	2e-11	54.9	Zinc finger, C3HC4 type (RING finger)
7	PF14634 zf-RING_5	34	15.8	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247668	0.999	TNF receptor-associated factor 2
2	9606.ENSP00000362994	0.999	TNF receptor-associated factor 1
3	9606.ENSP00000381717	0.999	Ubiquitin-conjugating enzyme E2 D2
4	9606.ENSP00000259808	0.998	Receptor-interacting serine/threonine-protein kinase 1
5	9606.ENSP00000398495	0.998	Diablo homolog, mitochondrial
6	9606.ENSP00000454207	0.998	TNF receptor-associated factor 3
7	9606.ENSP00000330237	0.997	Caspase-9
8	9606.ENSP00000311032	0.996	Caspase-3
9	9606.ENSP00000162749	0.995	Tumor necrosis factor receptor superfamily member 1A
10	9606.ENSP00000341268	0.992	Tumor necrosis factor receptor type 1-associated DEATH domain protein
11	9606.ENSP00000351273	0.990	Caspase-8
12	9606.ENSP00000398698	0.987	Tumor necrosis factor
13	9606.ENSP00000358327	0.986	Caspase-7
14	9606.ENSP00000433623	0.986	TNF receptor-associated factor 6
15	9606.ENSP00000384273	0.984	Transcription factor p65
16	9606.ENSP00000312455	0.983	CASP8 and FADD-like apoptosis regulator
17	9606.ENSP00000361359	0.983	Tumor necrosis factor receptor superfamily member 5
18	9606.ENSP00000220751	0.982	Receptor-interacting serine/threonine-protein kinase 2
19	9606.ENSP00000316176	0.979	Ubiquitin-conjugating enzyme E2 N
20	9606.ENSP00000261464	0.975	TNF receptor-associated factor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.999	ubiquitin-protein transferase activity
GO:0042802	0.714	identical protein binding
GO:0019899	0.488	enzyme binding
GO:0098772	0.406	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0009987	0.986	cellular process
GO:0043067	0.985	regulation of programmed cell death
GO:0019222	0.981	regulation of metabolic process
GO:0043069	0.978	negative regulation of programmed cell death
GO:0048518	0.975	positive regulation of biological process
GO:0051716	0.973	cellular response to stimulus
GO:0080090	0.973	regulation of primary metabolic process
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0048522	0.972	positive regulation of cellular process
GO:0048583	0.964	regulation of response to stimulus
GO:0042981	0.959	regulation of apoptotic process
GO:0043066	0.950	negative regulation of apoptotic process
GO:0080134	0.947	regulation of response to stress
GO:0050776	0.947	regulation of immune response
GO:0048584	0.941	positive regulation of response to stimulus
GO:0031347	0.941	regulation of defense response
GO:0002831	0.939	regulation of response to biotic stimulus
GO:0023052	0.936	signaling
GO:0071356	0.936	cellular response to tumor necrosis factor
GO:0007165	0.932	signal transduction
GO:0045088	0.931	regulation of innate immune response
GO:0062207	0.919	regulation of pattern recognition receptor signaling pathway
GO:0023056	0.909	positive regulation of signaling
GO:0010647	0.909	positive regulation of cell communication
GO:0009967	0.897	positive regulation of signal transduction
GO:0043122	0.887	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0031398	0.883	positive regulation of protein ubiquitination
GO:0030162	0.880	regulation of proteolysis
GO:1902533	0.869	positive regulation of intracellular signal transduction
GO:0043123	0.813	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0065009	0.771	regulation of molecular function
GO:0019221	0.726	cytokine-mediated signaling pathway
GO:0035556	0.721	intracellular signal transduction
GO:0050727	0.688	regulation of inflammatory response
GO:0071704	0.639	organic substance metabolic process
GO:0010939	0.632	regulation of necrotic cell death
GO:0044238	0.627	primary metabolic process
GO:0050790	0.610	regulation of catalytic activity
GO:0033209	0.607	tumor necrosis factor-mediated signaling pathway
GO:0031323	0.598	regulation of cellular metabolic process
GO:0006807	0.590	nitrogen compound metabolic process
GO:0007249	0.555	I-kappaB kinase/NF-kappaB signaling
GO:0039531	0.541	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0052547	0.528	regulation of peptidase activity
GO:0052548	0.509	regulation of endopeptidase activity
GO:0043170	0.508	macromolecule metabolic process
GO:1901564	0.482	organonitrogen compound metabolic process
GO:0006950	0.463	response to stress
GO:0010468	0.459	regulation of gene expression
GO:2000116	0.451	regulation of cysteine-type endopeptidase activity
GO:0019538	0.410	protein metabolic process
GO:0044237	0.354	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0032991	0.709	protein-containing complex
GO:0016020	0.344	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]