StarFunc result for job id Q13490

User Input

>input (618 residues)
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13490	1.000	1.000	1.866E-97	618	1.000	1.000	Q13490.pdb.gz	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
2	AFDB:Q62210	0.720	0.727	7.978E-81	612	0.833	0.842	Q62210.pdb.gz	BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Birc2 PE=1 SV=1
3	AFDB:Q13489	0.631	0.644	3.903E-71	604	0.706	0.722	Q13489.pdb.gz	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
4	AFDB:A0A669KBC7	0.446	0.430	1.425E-67	645	0.699	0.670	A0A669KBC7.pdb.gz	A0A669KBC7_HUMAN Baculoviral IAP repeat containing 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=1
5	AFDB:F7FLN8	0.424	0.413	1.231E-66	638	0.663	0.643	F7FLN8.pdb.gz	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
6	AFDB:O08863	0.512	0.522	2.590E-65	600	0.649	0.668	O08863.pdb.gz	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
7	AFDB:Q90660	0.489	0.494	2.963E-64	611	0.681	0.689	Q90660.pdb.gz	BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus OX=9031 GN=ITA PE=2 SV=1
8	AFDB:H0YZU0	0.147	0.184	1.854E-32	485	0.328	0.419	H0YZU0.pdb.gz	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
9	AFDB:Q60989	0.163	0.198	2.827E-32	496	0.316	0.393	Q60989.pdb.gz	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
10	AFDB:P98170	0.154	0.190	9.561E-32	497	0.312	0.388	P98170.pdb.gz	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
11	PDB:6b5bA	0.135	0.071	9.100E-11	1199	0.157	0.081	6b5bA.pdb.gz
12	PDB:5yudA	0.134	0.068	4.199E-7	1238	0.105	0.053	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
13	PDB:3uedC	0.124	0.503	3.757E-4	139	0.045	0.201	3uedC.pdb.gz	Molecular basis for phosphospecific recognition of histone H3 tails by Survivin paralogues at inner centromeres.
14	PDB:1m4mA	0.123	0.620	4.531E-4	112	0.042	0.232	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
15	PDB:4ikmA	0.132	0.175	8.285E-3	463	0.036	0.048	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
16	PDB:6mksA	0.127	0.819	8.683E-3	90	0.047	0.322	6mksA.pdb.gz
17	PDB:4irlB	0.119	0.157	5.155E-2	463	0.034	0.045	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
18	PDB:5juyB	0.135	0.069	1.316E-1	1234	0.034	0.017	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
19	PDB:6ki0A	0.125	0.167	2.421E-1	459	0.036	0.048	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
20	PDB:1dgnA	0.129	0.817	2.786E-1	89	0.036	0.247	1dgnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTI9	0.0	850	638	0.670	0.649	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
2	A0A669KBC7	0.0	866	645	0.712	0.682	A0A669KBC7_HUMAN Baculoviral IAP repeat containing 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=1
3	A0A8I6ADV9	0.0	883	537	0.696	0.801	A0A8I6ADV9_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=4 SV=1
4	F7FLN8	0.0	826	602	0.654	0.671	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
5	O08863	0.0	840	600	0.657	0.677	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
6	Q13489	0.0	886	604	0.712	0.728	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
7	Q13490	0.0	1296	618	1.000	1.000	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
8	Q5XIW4	0.0	843	602	0.659	0.676	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
9	Q62210	0.0	1047	612	0.837	0.845	BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Birc2 PE=1 SV=1
10	Q6P6S1	0.0	1008	589	0.791	0.830	Q6P6S1_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=3 SV=1
11	Q90660	0.0	848	611	0.684	0.692	BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus OX=9031 GN=ITA PE=2 SV=1
12	P98170	3.43e-89	287	497	0.264	0.328	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
13	A5D8Q0	1.16e-87	283	488	0.267	0.338	XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2
14	Q60989	1.80e-87	283	496	0.261	0.325	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
15	Q9R0I6	3.59e-87	282	496	0.269	0.335	XIAP_RAT E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus OX=10116 GN=Xiap PE=2 SV=1
16	H0YZU0	1.60e-85	277	485	0.261	0.332	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
17	Q24307	5.63e-80	263	498	0.290	0.359	DIAP2_DROME Death-associated inhibitor of apoptosis 2 OS=Drosophila melanogaster OX=7227 GN=Diap2 PE=1 SV=3
18	Q8JHV9	9.37e-66	223	401	0.191	0.294	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
19	P41437	1.60e-48	172	268	0.123	0.284	IAP3_NPVOP E3 ubiquitin-protein ligase IAP-3 OS=Orgyia pseudotsugata multicapsid polyhedrosis virus OX=262177 GN=IAP3 PE=3 SV=1
20	Q9R016	2.01e-44	172	1403	0.194	0.086	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e OS=Mus musculus OX=10090 GN=Naip5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00653 BIR	4.3e-62	218.0	Inhibitor of Apoptosis domain
2	PF00619 CARD	4.6e-20	82.7	Caspase recruitment domain
3	PF10217 DUF2039	2.4e+02	13.4	Uncharacterized conserved protein (DUF2039)
4	PF08753 NikR_C	2.7e+02	13.1	NikR C terminal nickel binding domain
5	PF14447 Prok-RING_4	0.00014	33.0	Prokaryotic RING finger family 4
6	PF13923 zf-C3HC4_2	23	16.2	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	6.1e-11	53.3	Zinc finger, C3HC4 type (RING finger)
8	PF14634 zf-RING_5	15	16.9	zinc-RING finger domain
9	PF13445 zf-RING_UBOX	7.7e+02	11.6	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477613

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.999	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000247668	0.999	TNF receptor-associated factor 2
3	9606.ENSP00000259808	0.999	Receptor-interacting serine/threonine-protein kinase 1
4	9606.ENSP00000341268	0.999	Tumor necrosis factor receptor type 1-associated DEATH domain protein
5	9606.ENSP00000362994	0.999	TNF receptor-associated factor 1
6	9606.ENSP00000398495	0.999	Diablo homolog, mitochondrial
7	9606.ENSP00000454207	0.999	TNF receptor-associated factor 3
8	9606.ENSP00000311032	0.998	Caspase-3
9	9606.ENSP00000330237	0.997	Caspase-9
10	9606.ENSP00000351273	0.997	Caspase-8
11	9606.ENSP00000398698	0.997	Tumor necrosis factor
12	9606.ENSP00000483825	0.997	NF-kappa-B essential modulator
13	9606.ENSP00000358327	0.996	Caspase-7
14	9606.ENSP00000261464	0.994	TNF receptor-associated factor 5
15	9606.ENSP00000220751	0.993	Receptor-interacting serine/threonine-protein kinase 2
16	9606.ENSP00000381717	0.993	Ubiquitin-conjugating enzyme E2 D2
17	9606.ENSP00000361359	0.991	Tumor necrosis factor receptor superfamily member 5
18	9606.ENSP00000363019	0.991	Ubiquitin-conjugating enzyme E2 D1
19	9606.ENSP00000360242	0.989	E3 ubiquitin-protein ligase XIAP
20	9606.ENSP00000349722	0.988	Ubiquitin conjugating enzyme E2 D3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0140096	0.995	catalytic activity, acting on a protein
GO:0004842	0.991	ubiquitin-protein transferase activity
GO:0042802	0.910	identical protein binding
GO:0032182	0.652	ubiquitin-like protein binding
GO:0051087	0.407	chaperone binding
GO:0003713	0.317	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.986	response to stimulus
GO:0048519	0.985	negative regulation of biological process
GO:0043067	0.985	regulation of programmed cell death
GO:0080090	0.983	regulation of primary metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0043069	0.980	negative regulation of programmed cell death
GO:0009987	0.978	cellular process
GO:0048518	0.970	positive regulation of biological process
GO:0048583	0.966	regulation of response to stimulus
GO:0051716	0.961	cellular response to stimulus
GO:0042981	0.944	regulation of apoptotic process
GO:0034612	0.940	response to tumor necrosis factor
GO:0071345	0.927	cellular response to cytokine stimulus
GO:0043066	0.926	negative regulation of apoptotic process
GO:0031398	0.915	positive regulation of protein ubiquitination
GO:0043122	0.895	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010939	0.892	regulation of necrotic cell death
GO:0071704	0.856	organic substance metabolic process
GO:0043123	0.834	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045088	0.826	regulation of innate immune response
GO:0071356	0.820	cellular response to tumor necrosis factor
GO:0044238	0.809	primary metabolic process
GO:0007165	0.790	signal transduction
GO:0043170	0.780	macromolecule metabolic process
GO:0065009	0.773	regulation of molecular function
GO:0006807	0.761	nitrogen compound metabolic process
GO:0019221	0.700	cytokine-mediated signaling pathway
GO:0035556	0.695	intracellular signal transduction
GO:0030162	0.686	regulation of proteolysis
GO:0031323	0.631	regulation of cellular metabolic process
GO:1901564	0.628	organonitrogen compound metabolic process
GO:0033209	0.618	tumor necrosis factor-mediated signaling pathway
GO:0019538	0.607	protein metabolic process
GO:0062207	0.599	regulation of pattern recognition receptor signaling pathway
GO:0039531	0.564	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0007249	0.557	I-kappaB kinase/NF-kappaB signaling
GO:0044237	0.542	cellular metabolic process
GO:0050790	0.492	regulation of catalytic activity
GO:0051336	0.416	regulation of hydrolase activity
GO:0006950	0.389	response to stress
GO:0010468	0.386	regulation of gene expression
GO:0036211	0.375	protein modification process
GO:0052547	0.346	regulation of peptidase activity
GO:0006508	0.332	proteolysis
GO:0052548	0.321	regulation of endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0032991	0.960	protein-containing complex
GO:0043233	0.947	organelle lumen
GO:0070013	0.942	intracellular organelle lumen
GO:0016020	0.900	membrane
GO:0031981	0.898	nuclear lumen
GO:0005654	0.875	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.992	Transferases.

[back to server]