StarFunc result for job id Q13491

User Input

>input (265 residues)
MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALA
GTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIASFFFLYGIILLAEGFYTTSAVKELH
GEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTT
GVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALL
IYMMATTYNYAVLKFKSREDCCTKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13491	1.000	1.000	1.316E-38	265	1.000	1.000	Q13491.pdb.gz	GPM6B_HUMAN Neuronal membrane glycoprotein M6-b OS=Homo sapiens OX=9606 GN=GPM6B PE=1 SV=2
2	AFDB:P35803	0.878	0.713	4.951E-33	328	0.913	0.738	P35803.pdb.gz	GPM6B_MOUSE Neuronal membrane glycoprotein M6-b OS=Mus musculus OX=10090 GN=Gpm6b PE=1 SV=2
3	AFDB:Q8UUT6	0.858	0.926	2.112E-23	245	0.502	0.543	Q8UUT6.pdb.gz	Q8UUT6_DANRE DMalpha1 OS=Danio rerio OX=7955 GN=wu:fj36d03 PE=1 SV=1
4	AFDB:P60201	0.794	0.761	7.999E-21	277	0.521	0.498	P60201.pdb.gz	MYPR_HUMAN Myelin proteolipid protein OS=Homo sapiens OX=9606 GN=PLP1 PE=1 SV=2
5	AFDB:P35802	0.843	0.805	3.148E-20	278	0.498	0.475	P35802.pdb.gz	GPM6A_MOUSE Neuronal membrane glycoprotein M6-a OS=Mus musculus OX=10090 GN=Gpm6a PE=1 SV=1
6	AFDB:F8W2C7	0.820	0.747	3.980E-19	292	0.442	0.401	F8W2C7.pdb.gz
7	AFDB:M9PFW7	0.746	0.670	4.233E-9	297	0.215	0.192	M9PFW7.pdb.gz	M9PFW7_DROME M6, isoform E OS=Drosophila melanogaster OX=7227 GN=M6 PE=4 SV=1
8	AFDB:M9PGC0	0.720	0.533	1.403E-7	368	0.208	0.149	M9PGC0.pdb.gz	M9PGC0_DROME M6, isoform F OS=Drosophila melanogaster OX=7227 GN=M6 PE=4 SV=1
9	AFDB:Q9H2W1	0.301	0.313	4.308E-2	248	0.106	0.113	Q9H2W1.pdb.gz	M4A6A_HUMAN Membrane-spanning 4-domains subfamily A member 6A OS=Homo sapiens OX=9606 GN=MS4A6A PE=1 SV=1
10	AFDB:Q7K010	0.297	0.335	1.316E-1	220	0.102	0.123	Q7K010.pdb.gz	Q7K010_DROME Tetraspanin OS=Drosophila melanogaster OX=7227 GN=Tsp42Ef PE=2 SV=1
11	PDB:7p5jA	0.287	0.200	4.620E-1	399	0.140	0.093	7p5jA.pdb.gz
12	PDB:6k4jA	0.258	0.296	5.379E-1	220	0.147	0.177	6k4jA.pdb.gz
13	PDB:7p54A	0.364	0.265	8.935E-1	397	0.147	0.098	7p54A.pdb.gz
14	PDB:7ru6A	0.128	0.113	9.400E-1	315	0.121	0.102	7ru6A.pdb.gz	Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.
15	PDB:7ph3A	0.242	0.127	9.889E-1	577	0.098	0.045	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
16	PDB:7sssE	0.183	0.261	1.040	173	0.064	0.098	7sssE.pdb.gz	Structure and functionality of a multimeric human COQ7:COQ9 complex.
17	PDB:7ungD2	0.191	0.143	1.095	398	0.128	0.085	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:4f4cA	0.161	0.051	1.151	1250	0.162	0.034	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
19	PDB:7p5cA	0.258	0.203	1.151	392	0.147	0.099	7p5cA.pdb.gz
20	PDB:7rroD1	0.226	0.151	1.211	425	0.143	0.089	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13491	0.0	542	265	1.000	1.000	GPM6B_HUMAN Neuronal membrane glycoprotein M6-b OS=Homo sapiens OX=9606 GN=GPM6B PE=1 SV=2
2	P35803	7.96e-172	479	328	0.909	0.735	GPM6B_MOUSE Neuronal membrane glycoprotein M6-b OS=Mus musculus OX=10090 GN=Gpm6b PE=1 SV=2
3	Q8UUT6	2.34e-97	287	245	0.498	0.539	Q8UUT6_DANRE DMalpha1 OS=Danio rerio OX=7955 GN=wu:fj36d03 PE=1 SV=1
4	P60201	1.09e-87	263	277	0.513	0.491	MYPR_HUMAN Myelin proteolipid protein OS=Homo sapiens OX=9606 GN=PLP1 PE=1 SV=2
5	P60202	1.09e-87	263	277	0.513	0.491	MYPR_MOUSE Myelin proteolipid protein OS=Mus musculus OX=10090 GN=Plp1 PE=1 SV=2
6	P60203	1.09e-87	263	277	0.513	0.491	MYPR_RAT Myelin proteolipid protein OS=Rattus norvegicus OX=10116 GN=Plp1 PE=1 SV=2
7	Q6DI17	3.65e-84	255	285	0.457	0.425	Q6DI17_DANRE Glycoprotein M6Ab OS=Danio rerio OX=7955 GN=DMbeta2 PE=1 SV=1
8	Q8UUT1	6.89e-79	241	274	0.434	0.420	Q8UUT1_DANRE DMbeta2b OS=Danio rerio OX=7955 GN=gm6a PE=1 SV=1
9	P35802	3.63e-78	239	278	0.502	0.478	GPM6A_MOUSE Neuronal membrane glycoprotein M6-a OS=Mus musculus OX=10090 GN=Gpm6a PE=1 SV=1
10	Q812E9	1.56e-77	238	278	0.498	0.475	GPM6A_RAT Neuronal membrane glycoprotein M6-a OS=Rattus norvegicus OX=10116 GN=Gpm6a PE=1 SV=1
11	P51674	1.76e-77	238	278	0.498	0.475	GPM6A_HUMAN Neuronal membrane glycoprotein M6-a OS=Homo sapiens OX=9606 GN=GPM6A PE=1 SV=2
12	Q86YB0	2.86e-77	237	278	0.498	0.475	Q86YB0_HUMAN Glycoprotein M6A OS=Homo sapiens OX=9606 GN=GPM6A PE=1 SV=1
13	Q8UUS9	1.86e-72	224	250	0.438	0.464	Q8UUS9_DANRE DMbeta2a OS=Danio rerio OX=7955 GN=gm6a PE=1 SV=1
14	M9PFW7	1.48e-15	77.0	297	0.242	0.215	M9PFW7_DROME M6, isoform E OS=Drosophila melanogaster OX=7227 GN=M6 PE=4 SV=1
15	Q7KI49	6.94e-15	75.1	314	0.238	0.201	Q7KI49_DROME LD13050p OS=Drosophila melanogaster OX=7227 GN=M6 PE=2 SV=1
16	Q9VP23	7.18e-15	75.1	319	0.238	0.197	Q9VP23_DROME M6, isoform C OS=Drosophila melanogaster OX=7227 GN=M6 PE=2 SV=2
17	M9PGC0	9.34e-15	75.1	368	0.238	0.171	M9PGC0_DROME M6, isoform F OS=Drosophila melanogaster OX=7227 GN=M6 PE=4 SV=1
18	Q78EF6	3.20e-14	67.4	52	0.121	0.615	Q78EF6_RAT Proteolipid protein variant DM-20 (Fragment) OS=Rattus norvegicus OX=10116 PE=4 SV=1
19	H9A9K2	1.10e-13	69.7	187	0.170	0.241	H9A9K2_DROME M6, isoform G OS=Drosophila melanogaster OX=7227 GN=M6 PE=2 SV=1
20	Q9NGC6	1.86e-13	70.1	248	0.170	0.181	Q9NGC6_DROME M6, isoform D OS=Drosophila melanogaster OX=7227 GN=M6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01275 Myelin_PLP	8.6e-101	348.1	Myelin proteolipid protein (PLP or lipophilin)
2	PF16991 SIR4_SID	6.8e+02	11.7	Sir4 SID domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10116.ENSRNOP00000006777

Rank	PPI partner	STRING score	Description
1	10116.ENSRNOP00000005663	0.739	Ankyrin repeat and SOCS box-containing 12
2	10116.ENSRNOP00000003714	0.707	Palmitoyltransferase ZDHHC15
3	10116.ENSRNOP00000005077	0.686	Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and probably mediates its effects by recruiting and clustering other synaptic proteins. May promote the initial formation of synapses, but is not essential for this. May also play a role in glia-glia or glia-neuron interactions in the developing peripheral nervous system.
4	10116.ENSRNOP00000053713	0.667	Transmembrane scaffolding protein involved in cell-cell interactions via its interactions with neurexin family members. Mediates cell-cell interactions both in neurons and in other types of cells, such as Langerhans beta cells. Plays a role in synapse function and synaptic signal transmission, especially via gamma-aminobutyric acid receptors (GABA(A) receptors). Functions by recruiting and clustering synaptic proteins. Promotes clustering of postsynaptic GABRG2 and GPHN. Promotes clustering of postsynaptic LHFPL4 (By similarity). Modulates signaling by inhibitory synapses, and thereby [...]
5	10116.ENSRNOP00000067153	0.659	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
6	10116.ENSRNOP00000018055	0.653	Epithelial cell transforming 2
7	10116.ENSRNOP00000014923	0.624	Functions as a GTPase-activating protein for the small GTPases RHOA, RHOB, RHOC and CDC42, terminating their downstream signaling. This induces morphological changes and detachment through cytoskeletal reorganization, playing a critical role in biological processes such as cell migration and proliferation. Also functions in vivo as an activator of the phospholipase PLCD1. Active DLC1 increases cell migration velocity but reduces directionality (By similarity).
8	10116.ENSRNOP00000038919	0.623	Zinc finger protein 12
9	10116.ENSRNOP00000023433	0.580	PQ-loop repeat-containing protein 1
10	10116.ENSRNOP00000036740	0.557	Synapsin-3
11	10116.ENSRNOP00000026793	0.554	Cell adhesion molecule 4
12	10116.ENSRNOP00000035271	0.550	May be involved in cell-adhesion. May function as a trans- neural growth-promoting factor in regenerative axon sprouting in the mammalian brain (By similarity)
13	10116.ENSRNOP00000063309	0.550	Translocon-associated protein subunit delta
14	10116.ENSRNOP00000002487	0.544	Replication factor C (activator 1) 4
15	10116.ENSRNOP00000010065	0.540	Rhophilin, Rho GTPase binding protein 1
16	10116.ENSRNOP00000053287	0.531	Regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1
17	10116.ENSRNOP00000059045	0.531	Disks large homolog 4
18	10116.ENSRNOP00000016987	0.528	Leucine repeat adapter protein 25
19	10116.ENSRNOP00000039739	0.519	TATA box-binding protein-like protein 2
20	10116.ENSRNOP00000007998	0.517	Synaptosomal-associated protein 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0044087	0.943	regulation of cellular component biogenesis
GO:0032501	0.817	multicellular organismal process
GO:0051128	0.812	regulation of cellular component organization
GO:0007399	0.714	nervous system development
GO:0071840	0.685	cellular component organization or biogenesis
GO:0016043	0.645	cellular component organization
GO:0048518	0.457	positive regulation of biological process
GO:0048522	0.347	positive regulation of cellular process
GO:0050896	0.340	response to stimulus
GO:0065008	0.306	regulation of biological quality
GO:0050793	0.303	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043226	0.710	organelle
GO:0043227	0.526	membrane-bounded organelle
GO:0030054	0.513	cell junction
GO:0005622	0.469	intracellular anatomical structure
GO:0045202	0.466	synapse
GO:0043229	0.412	intracellular organelle
GO:0005737	0.404	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]