StarFunc result for job id Q13495

User Input

>input (774 residues)
MDDWKSRLVIKSMLPHFAMVGNRQEPRKLQESGKKPSWMEEEDLSFLYKSSPGRKHQGTV
KRRQEEDHFQFPDMADGGYPNKIKRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPSPA
AMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELL
EELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSHLESLASSKEFA
SSCSQVTGMSLQIPSSSTGISYSIPSTSKQIVSPSSSMAQSKSQVQAMLPVALPPLPVPQ
WHHAHQLKALAASKQGSATKQQGPTPSWSGLPPPGLSPPYRPVPSPHPPPLPLPPPPPPF
SPQSLMVSCMSSNTLSGSTLRGSPNALLSSMTSSSNAALGPAMPYAPEKLPSPALTQQPQ
FGPQSSILANLMSSTIKTPQGHLMSALPASNPGPSPPYRPEKLSSPGLPQQSFTPQCSLI
RSLTPTSNLLSQQQQQQQQQQQANVIFKPISSNSSKTLSMIMQQGMASSSPGATEPFTFG
NTKPLSHFVSEPGPQKMPSMPTTSRQPSLLHYLQQPTPTQASSATASSTATATLQLQQQQ
QQQQQQPDHSSFLLQQMMQQPQRFQRSVASDSMPALPRQGCCHLFAWTSAASSVKPQHQH
GNSFTSRQDPQPGDVSPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSF
AHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13495	0.999	0.999	0.000	774	1.000	1.000	Q13495.pdb.gz	MAMD1_HUMAN Mastermind-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAMLD1 PE=1 SV=2
2	AFDB:Q9H7P9	0.049	0.033	2.621E-3	1386	0.190	0.106	Q9H7P9.pdb.gz	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
3	AFDB:Q6T264	0.041	0.044	9.584E-3	1020	0.196	0.149	Q6T264.pdb.gz	MAML1_MOUSE Mastermind-like protein 1 OS=Mus musculus OX=10090 GN=Maml1 PE=1 SV=2
4	AFDB:Q9ULK2	0.047	0.047	1.034E-2	861	0.177	0.159	Q9ULK2.pdb.gz	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
5	AFDB:E7F640	0.061	0.056	2.055E-2	866	0.156	0.140	E7F640.pdb.gz	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
6	AFDB:A0A0B4KHZ9	0.048	0.036	3.505E-2	1151	0.158	0.106	A0A0B4KHZ9.pdb.gz	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
7	AFDB:O60393	0.050	0.055	3.782E-2	691	0.164	0.184	O60393.pdb.gz	NOBOX_HUMAN Homeobox protein NOBOX OS=Homo sapiens OX=9606 GN=NOBOX PE=1 SV=4
8	AFDB:P11536	0.054	0.049	7.514E-2	883	0.128	0.112	P11536.pdb.gz	E74EB_DROME Ecdysone-induced protein 74EF isoform B OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
9	AFDB:P50111	0.054	0.049	8.752E-2	915	0.124	0.105	P50111.pdb.gz	ZDS1_YEAST Protein ZDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZDS1 PE=1 SV=1
10	AFDB:Q96JE9	0.053	0.051	1.019E-1	813	0.152	0.145	Q96JE9.pdb.gz	MAP6_HUMAN Microtubule-associated protein 6 OS=Homo sapiens OX=9606 GN=MAP6 PE=1 SV=2
11	PDB:3j6bM	0.038	0.152	8.197	151	0.016	0.079	3j6bM.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C6A2	0.0	866	803	0.744	0.717	MAMD1_MOUSE Mastermind-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mamld1 PE=3 SV=1
2	Q13495	0.0	1546	774	1.000	1.000	MAMD1_HUMAN Mastermind-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAMLD1 PE=1 SV=2
3	Q8IZL2	1.33e-07	57.8	1156	0.061	0.041	MAML2_HUMAN Mastermind-like protein 2 OS=Homo sapiens OX=9606 GN=MAML2 PE=1 SV=2
4	P50615	0.33	36.2	252	0.036	0.111	BTG3_MOUSE Protein BTG3 OS=Mus musculus OX=10090 GN=Btg3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000038527

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000028252	0.957	Mastermind-like 3 (Drosophila)
2	9598.ENSPTRP00000044315	0.844	Recombination signal binding protein for immunoglobulin kappa J region
3	9598.ENSPTRP00000009839	0.793	Mab-21-like 1
4	9598.ENSPTRP00000007798	0.727	Anoctamin 2, calcium activated chloride channel
5	9598.ENSPTRP00000007220	0.706	Mastermind-like 2 (Drosophila)
6	9598.ENSPTRP00000051156	0.668	Upstream transcription factor family member 3
7	9598.ENSPTRP00000038536	0.666	Myotubularin related protein 1
8	9598.ENSPTRP00000000999	0.656	Hes related family bHLH transcription factor with YRPW motif-like
9	9598.ENSPTRP00000036143	0.653	Hydroxysteroid (17-beta) dehydrogenase 3
10	9598.ENSPTRP00000031473	0.626	BTB and CNC homology 1, basic leucine zipper transcription factor 2
11	9598.ENSPTRP00000038209	0.620	Uncharacterized protein
12	9598.ENSPTRP00000000150	0.615	Hes family bHLH transcription factor 3
13	9598.ENSPTRP00000002296	0.592	Uncharacterized protein
14	9598.ENSPTRP00000046360	0.592	Uncharacterized protein
15	9598.ENSPTRP00000011189	0.583	SNW domain containing 1
16	9598.ENSPTRP00000017317	0.580	Strawberry notch homolog 2 (Drosophila)
17	9598.ENSPTRP00000024841	0.574	Pan troglodytes E1A binding protein p300 (EP300), mRNA
18	9598.ENSPTRP00000002008	0.570	Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
19	9598.ENSPTRP00000045795	0.552	Uncharacterized protein
20	9598.ENSPTRP00000047146	0.552	YY1 associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.913	transcription regulator activity
GO:0003712	0.892	transcription coregulator activity
GO:0003713	0.789	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.993	multicellular organism development
GO:0048731	0.982	system development
GO:0048513	0.966	animal organ development
GO:0050794	0.922	regulation of cellular process
GO:0019222	0.882	regulation of metabolic process
GO:0080090	0.874	regulation of primary metabolic process
GO:0031323	0.872	regulation of cellular metabolic process
GO:0060255	0.871	regulation of macromolecule metabolic process
GO:0051171	0.867	regulation of nitrogen compound metabolic process
GO:0006357	0.862	regulation of transcription by RNA polymerase II
GO:0007548	0.847	sex differentiation
GO:0061458	0.803	reproductive system development
GO:0048608	0.689	reproductive structure development
GO:0045137	0.680	development of primary sexual characteristics
GO:0046661	0.664	male sex differentiation
GO:0008406	0.627	gonad development
GO:0046546	0.587	development of primary male sexual characteristics
GO:0008584	0.489	male gonad development
GO:0009987	0.424	cellular process
GO:0048518	0.357	positive regulation of biological process
GO:0048522	0.350	positive regulation of cellular process
GO:0050896	0.348	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.998	Golgi apparatus
GO:0016604	0.996	nuclear body
GO:0005813	0.995	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]