StarFunc result for job id Q13501

User Input

>input (440 residues)
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64337	0.496	0.495	7.186E-70	442	0.911	0.907	Q64337.pdb.gz	SQSTM_MOUSE Sequestosome-1 OS=Mus musculus OX=10090 GN=Sqstm1 PE=1 SV=1
2	AFDB:F1Q5Z8	0.201	0.196	8.200E-40	452	0.486	0.473	F1Q5Z8.pdb.gz	F1Q5Z8_DANRE Sequestosome-1 OS=Danio rerio OX=7955 GN=p62 PE=2 SV=1
3	AFDB:Q38CG8	0.168	0.074	2.640E-4	1083	0.152	0.062	Q38CG8.pdb.gz	Q38CG8_TRYB2 PB1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7490 PE=4 SV=1
4	PDB:2dybA	0.163	0.231	9.569E-4	298	0.055	0.081	2dybA.pdb.gz
5	PDB:6hivCv	0.159	0.069	4.129E-3	1059	0.045	0.019	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
6	PDB:4x57B	0.144	0.459	1.236E-2	93	0.016	0.075	4x57B.pdb.gz
7	PDB:4rm8A	0.157	0.185	3.083E-2	368	0.032	0.038	4rm8A.pdb.gz
8	PDB:6tdaL	0.090	0.067	3.702E-2	596	0.032	0.023	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
9	PDB:6mdhA	0.135	0.353	4.181E-2	149	0.023	0.067	6mdhA.pdb.gz
10	PDB:5swpA	0.139	0.065	6.405E-2	1060	0.023	0.009	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
11	PDB:5itdA	0.137	0.066	7.235E-2	995	0.025	0.011	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
12	PDB:6k15H	0.104	0.115	7.235E-2	393	0.034	0.038	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
13	AFDB:Q56WK6	0.065	0.052	1.034E-1	573	0.098	0.075	Q56WK6.pdb.gz	PATL1_ARATH Patellin-1 OS=Arabidopsis thaliana OX=3702 GN=PATL1 PE=1 SV=2
14	PDB:7dd9A	0.098	0.039	1.178E-1	1129	0.030	0.012	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
15	AFDB:Q09003	0.130	0.111	1.584E-1	536	0.127	0.104	Q09003.pdb.gz	COIL_XENLA Coilin OS=Xenopus laevis OX=8355 GN=coil PE=2 SV=2
16	AFDB:Q53SF7	0.148	0.072	3.498E-1	1128	0.130	0.051	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
17	AFDB:Q10407	0.141	0.060	4.463E-1	1116	0.132	0.052	Q10407.pdb.gz	MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mkh1 PE=3 SV=1
18	AFDB:P35820	0.131	0.045	5.695E-1	1601	0.120	0.033	P35820.pdb.gz	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
19	AFDB:Q9LQZ7	0.085	0.110	7.266E-1	331	0.100	0.133	Q9LQZ7.pdb.gz	BBX21_ARATH B-box zinc finger protein 21 OS=Arabidopsis thaliana OX=3702 GN=BBX21 PE=1 SV=1
20	AFDB:Q13191	0.101	0.049	1.047	982	0.109	0.049	Q13191.pdb.gz	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7GSB8	0.0	879	440	0.975	0.975	F7GSB8_MACMU Sequestosome 1 OS=Macaca mulatta OX=9544 GN=SQSTM1 PE=4 SV=3
2	O08623	0.0	810	439	0.914	0.916	SQSTM_RAT Sequestosome-1 OS=Rattus norvegicus OX=10116 GN=Sqstm1 PE=1 SV=1
3	Q13501	0.0	900	440	1.000	1.000	SQSTM_HUMAN Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1
4	Q64337	0.0	792	442	0.911	0.907	SQSTM_MOUSE Sequestosome-1 OS=Mus musculus OX=10090 GN=Sqstm1 PE=1 SV=1
5	F1Q5Z8	2.53e-122	365	452	0.482	0.469	F1Q5Z8_DANRE Sequestosome-1 OS=Danio rerio OX=7955 GN=p62 PE=2 SV=1
6	Q55CE3	1.34e-09	62.8	646	0.086	0.059	Q55CE3_DICDI ZZ-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0270098 PE=4 SV=1
7	F1LIM5	7.34e-08	57.0	621	0.070	0.050	F1LIM5_CAEEL ZZ-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sqst-1 PE=1 SV=1
8	Q22436	7.39e-08	57.0	693	0.070	0.045	Q22436_CAEEL ZZ-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sqst-1 PE=1 SV=2
9	Q9N3Z0	1.23e-07	54.7	242	0.052	0.095	Q9N3Z0_CAEEL ZZ-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sqst-2 PE=1 SV=2
10	B7Z5R6	1.56e-07	56.2	837	0.057	0.030	B7Z5R6_HUMAN NBR1 autophagy cargo receptor OS=Homo sapiens OX=9606 GN=NBR1 PE=1 SV=1
11	Q14596	1.62e-07	56.2	966	0.057	0.026	NBR1_HUMAN Next to BRCA1 gene 1 protein OS=Homo sapiens OX=9606 GN=NBR1 PE=1 SV=3
12	Q17746	1.81e-07	55.5	498	0.041	0.036	Q17746_CAEEL ZZ-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C06G3.6 PE=1 SV=1
13	P14199	7.62e-07	53.9	599	0.055	0.040	REF2P_DROME Protein ref(2)P OS=Drosophila melanogaster OX=7227 GN=ref(2)P PE=1 SV=2
14	P97432	3.96e-06	51.6	988	0.057	0.025	NBR1_MOUSE Next to BRCA1 gene 1 protein OS=Mus musculus OX=10090 GN=Nbr1 PE=1 SV=1
15	Q9VUX2	2.54e-05	49.3	1226	0.077	0.028	MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3
16	Q86YT6	3.42e-05	48.9	1006	0.080	0.035	MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1
17	Q80SY4	3.57e-05	48.5	1006	0.080	0.035	MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1
18	D3ZUV2	3.60e-05	48.5	1006	0.080	0.035	D3ZUV2_RAT RING-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Mib1 PE=4 SV=3
19	A0AR23	3.86e-05	48.5	999	0.043	0.019	A0AR23_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=mib2 PE=2 SV=1
20	Q9VJ14	6.49e-05	47.8	1049	0.041	0.017	Q9VJ14_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=mib2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	3.7	19.3	C1 domain
2	PF00564 PB1	8e-08	43.4	PB1 domain
3	PF16577 UBA_5	2e-40	148.1	UBA domain
4	PF00569 ZZ	1.9e-08	45.3	Zinc finger, ZZ type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374455

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000037243	0.999	Gamma-aminobutyric acid receptor-associated protein-like 2
2	9606.ENSP00000171111	0.999	Kelch-like ECH-associated protein 1
3	9606.ENSP00000268607	0.999	Microtubule-associated proteins 1A/1B light chain 3B
4	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
5	9606.ENSP00000266458	0.998	Gamma-aminobutyric acid receptor-associated protein-like 1
6	9606.ENSP00000295797	0.998	Protein kinase C iota type
7	9606.ENSP00000363970	0.998	Microtubule-associated proteins 1A/1B light chain 3A
8	9606.ENSP00000367830	0.998	Protein kinase C zeta type
9	9606.ENSP00000295888	0.997	WD repeat and FYVE domain-containing protein 3
10	9606.ENSP00000306866	0.997	Gamma-aminobutyric acid receptor-associated protein
11	9606.ENSP00000392025	0.992	Ubiquitin carboxyl-terminal hydrolase CYLD
12	9606.ENSP00000431418	0.992	High affinity nerve growth factor receptor
13	9606.ENSP00000259808	0.991	Receptor-interacting serine/threonine-protein kinase 1
14	9606.ENSP00000351273	0.991	Caspase-8
15	9606.ENSP00000441543	0.988	Polyubiquitin-C
16	9606.ENSP00000307272	0.986	Regulatory-associated protein of mTOR
17	9606.ENSP00000324173	0.982	78 kDa glucose-regulated protein
18	9606.ENSP00000358081	0.980	BAG family molecular chaperone regulator 3
19	9606.ENSP00000430684	0.979	Inhibitor of nuclear factor kappa-B kinase subunit beta
20	9606.ENSP00000329967	0.978	Serine/threonine-protein kinase TBK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019901	0.996	protein kinase binding
GO:0070530	0.991	K63-linked polyubiquitin modification-dependent protein binding
GO:0005102	0.955	signaling receptor binding
GO:0140110	0.912	transcription regulator activity
GO:0035254	0.907	glutamate receptor binding
GO:0035255	0.904	ionotropic glutamate receptor binding
GO:0003712	0.897	transcription coregulator activity
GO:0005080	0.819	protein kinase C binding
GO:0003824	0.333	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0008152	0.996	metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0044237	0.994	cellular metabolic process
GO:0080090	0.988	regulation of primary metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0048519	0.987	negative regulation of biological process
GO:0009056	0.986	catabolic process
GO:0048518	0.979	positive regulation of biological process
GO:0061919	0.971	process utilizing autophagic mechanism
GO:0050896	0.969	response to stimulus
GO:0051246	0.967	regulation of protein metabolic process
GO:0031399	0.964	regulation of protein modification process
GO:0044248	0.962	cellular catabolic process
GO:0048522	0.958	positive regulation of cellular process
GO:0031323	0.949	regulation of cellular metabolic process
GO:0071704	0.882	organic substance metabolic process
GO:0044238	0.839	primary metabolic process
GO:0006807	0.818	nitrogen compound metabolic process
GO:0023051	0.816	regulation of signaling
GO:0010646	0.815	regulation of cell communication
GO:0051179	0.805	localization
GO:0043170	0.792	macromolecule metabolic process
GO:0009893	0.788	positive regulation of metabolic process
GO:0051716	0.784	cellular response to stimulus
GO:1901564	0.770	organonitrogen compound metabolic process
GO:0048523	0.770	negative regulation of cellular process
GO:0006950	0.766	response to stress
GO:0010468	0.763	regulation of gene expression
GO:0019538	0.760	protein metabolic process
GO:0051641	0.733	cellular localization
GO:0009889	0.733	regulation of biosynthetic process
GO:0006914	0.729	autophagy
GO:0019219	0.729	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.723	regulation of macromolecule biosynthetic process
GO:0031326	0.722	regulation of cellular biosynthetic process
GO:0051252	0.717	regulation of RNA metabolic process
GO:0031325	0.642	positive regulation of cellular metabolic process
GO:0048583	0.613	regulation of response to stimulus
GO:0010604	0.604	positive regulation of macromolecule metabolic process
GO:0051173	0.597	positive regulation of nitrogen compound metabolic process
GO:0006355	0.596	regulation of DNA-templated transcription
GO:0071840	0.594	cellular component organization or biogenesis
GO:0009892	0.582	negative regulation of metabolic process
GO:0016043	0.537	cellular component organization
GO:0036211	0.511	protein modification process
GO:0007154	0.507	cell communication
GO:0051172	0.488	negative regulation of nitrogen compound metabolic process
GO:0010605	0.488	negative regulation of macromolecule metabolic process
GO:0023052	0.484	signaling
GO:0006810	0.472	transport
GO:0009966	0.470	regulation of signal transduction
GO:0023056	0.466	positive regulation of signaling
GO:0007165	0.427	signal transduction
GO:0010647	0.390	positive regulation of cell communication
GO:0032879	0.364	regulation of localization
GO:0031324	0.364	negative regulation of cellular metabolic process
GO:0010941	0.360	regulation of cell death
GO:1903320	0.356	regulation of protein modification by small protein conjugation or removal
GO:0065009	0.335	regulation of molecular function
GO:0048584	0.334	positive regulation of response to stimulus
GO:0051649	0.327	establishment of localization in cell
GO:0008104	0.327	protein localization
GO:0051247	0.325	positive regulation of protein metabolic process
GO:0046907	0.318	intracellular transport
GO:1902531	0.313	regulation of intracellular signal transduction
GO:0006357	0.309	regulation of transcription by RNA polymerase II
GO:0065008	0.302	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016234	0.996	inclusion body
GO:0005829	0.978	cytosol
GO:0070013	0.970	intracellular organelle lumen
GO:0005739	0.970	mitochondrion
GO:0005634	0.866	nucleus
GO:0016020	0.859	membrane
GO:0031981	0.840	nuclear lumen
GO:0005654	0.795	nucleoplasm
GO:0032991	0.755	protein-containing complex
GO:0000323	0.745	lytic vacuole
GO:0005764	0.726	lysosome
GO:0005776	0.691	autophagosome
GO:0043232	0.624	intracellular non-membrane-bounded organelle
GO:0005576	0.570	extracellular region
GO:0031982	0.512	vesicle
GO:0070062	0.498	extracellular exosome
GO:0044754	0.409	autolysosome
GO:0012505	0.336	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]