StarFunc result for job id Q13503

User Input

>input (144 residues)
MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAA
LIARTAKDIDVLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQS
ALADIAQSQLKTRSGTHSQSLPDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4AA11	0.977	0.977	1.193E-19	144	0.986	0.986	D4AA11.pdb.gz	D4AA11_RAT Mediator of RNA polymerase II transcription subunit 21 OS=Rattus norvegicus OX=10116 GN=Med21 PE=3 SV=3
2	PDB:7nvrn	0.757	0.819	3.169E-15	132	0.910	0.992	7nvrn.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
3	AFDB:Q9W5P1	0.480	0.487	3.449E-11	142	0.521	0.528	Q9W5P1.pdb.gz	MED21_DROME Mediator of RNA polymerase II transcription subunit 21 OS=Drosophila melanogaster OX=7227 GN=MED21 PE=1 SV=1
4	AFDB:Q6BER6	0.436	0.479	4.114E-6	130	0.361	0.400	Q6BER6.pdb.gz	MED21_CAEEL Mediator of RNA polymerase II transcription subunit 21 OS=Caenorhabditis elegans OX=6239 GN=mdt-21 PE=1 SV=1
5	AFDB:C0LU16	0.783	0.810	7.381E-6	139	0.236	0.245	C0LU16.pdb.gz	MED21_ARATH Mediator of RNA polymerase II transcription subunit 21 OS=Arabidopsis thaliana OX=3702 GN=MED21 PE=1 SV=1
6	AFDB:P47822	0.748	0.767	1.778E-4	140	0.229	0.236	P47822.pdb.gz	MED21_YEAST Mediator of RNA polymerase II transcription subunit 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRB7 PE=1 SV=1
7	PDB:5oqmn	0.722	0.761	5.675E-4	136	0.194	0.206	5oqmn.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
8	AFDB:O94376	0.457	0.473	1.966E-3	138	0.229	0.239	O94376.pdb.gz	MED21_SCHPO Mediator of RNA polymerase II transcription subunit 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med21 PE=1 SV=1
9	PDB:1ykhB	0.645	0.799	3.071E-3	114	0.188	0.237	1ykhB.pdb.gz
10	PDB:5n9jD	0.567	0.597	3.731E-3	135	0.201	0.215	5n9jD.pdb.gz
11	PDB:7enav	0.366	0.384	7.896E-2	134	0.104	0.112	7enav.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
12	AFDB:O18397	0.270	0.072	9.678E-2	784	0.167	0.031	O18397.pdb.gz	O18397_DROME Oxysterol-binding protein OS=Drosophila melanogaster OX=7227 GN=Osbp PE=2 SV=2
13	AFDB:Q387I6	0.373	0.384	1.255E-1	139	0.167	0.173	Q387I6.pdb.gz	Q387I6_TRYB2 Mediator of RNA polymerase II transcription subunit 21 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0430 PE=4 SV=1
14	AFDB:P0DTS9	0.378	0.202	1.736E-1	280	0.111	0.057	P0DTS9.pdb.gz	TIRS_STAAS NAD(+) hydrolase TirS OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=tirS PE=1 SV=1
15	AFDB:Q15528	0.368	0.277	1.853E-1	200	0.132	0.095	Q15528.pdb.gz	MED22_HUMAN Mediator of RNA polymerase II transcription subunit 22 OS=Homo sapiens OX=9606 GN=MED22 PE=1 SV=2
16	PDB:5n9jE	0.366	0.270	6.732E-1	201	0.139	0.100	5n9jE.pdb.gz
17	PDB:5oqmk	0.336	0.379	6.732E-1	127	0.139	0.157	5oqmk.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:4n78F	0.352	0.327	7.666E-1	156	0.153	0.141	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
19	PDB:7emf2	0.340	0.415	7.666E-1	115	0.104	0.130	7emf2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:7lbmn	0.359	0.186	7.666E-1	283	0.083	0.042	7lbmn.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13503	6.29e-103	292	144	1.000	1.000	MED21_HUMAN Mediator of RNA polymerase II transcription subunit 21 OS=Homo sapiens OX=9606 GN=MED21 PE=1 SV=1
2	D4AA11	8.04e-101	286	144	0.986	0.986	D4AA11_RAT Mediator of RNA polymerase II transcription subunit 21 OS=Rattus norvegicus OX=10116 GN=Med21 PE=3 SV=3
3	Q9CQ39	4.26e-100	285	144	0.979	0.979	MED21_MOUSE Mediator of RNA polymerase II transcription subunit 21 OS=Mus musculus OX=10090 GN=Med21 PE=1 SV=1
4	A0A8I5ZZK3	2.76e-89	259	186	0.889	0.688	A0A8I5ZZK3_RAT Mediator of RNA polymerase II transcription subunit 21 OS=Rattus norvegicus OX=10116 GN=Med21 PE=3 SV=1
5	Q9W5P1	2.84e-42	139	142	0.542	0.549	MED21_DROME Mediator of RNA polymerase II transcription subunit 21 OS=Drosophila melanogaster OX=7227 GN=MED21 PE=1 SV=1
6	A0A0S2Z545	2.32e-32	111	73	0.361	0.712	A0A0S2Z545_HUMAN Mediator of RNA polymerase II transcription subunit 21 OS=Homo sapiens OX=9606 GN=MED21 PE=1 SV=1
7	Q6BER6	1.86e-20	82.8	130	0.347	0.385	MED21_CAEEL Mediator of RNA polymerase II transcription subunit 21 OS=Caenorhabditis elegans OX=6239 GN=mdt-21 PE=1 SV=1
8	C0LU16	3.67e-05	43.1	139	0.243	0.252	MED21_ARATH Mediator of RNA polymerase II transcription subunit 21 OS=Arabidopsis thaliana OX=3702 GN=MED21 PE=1 SV=1
9	P47822	0.004	37.7	140	0.243	0.250	MED21_YEAST Mediator of RNA polymerase II transcription subunit 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRB7 PE=1 SV=1
10	O94376	2.9	29.3	138	0.215	0.225	MED21_SCHPO Mediator of RNA polymerase II transcription subunit 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med21 PE=1 SV=1
11	Q8LL04	3.0	30.0	1241	0.132	0.015	CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana OX=3702 GN=CPL3 PE=1 SV=2
12	Q92851	3.1	30.0	521	0.153	0.042	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
13	P19367	3.4	30.0	917	0.181	0.028	HXK1_HUMAN Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1 PE=1 SV=3
14	Q6AWW6	3.9	29.6	512	0.201	0.057	Q6AWW6_ARATH At2g47310 OS=Arabidopsis thaliana OX=3702 GN=At2g47310 PE=1 SV=1
15	Q86NN0	3.9	29.6	1545	0.090	0.008	Q86NN0_DROME AT10293p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=2 SV=1
16	Q71JA7	4.4	29.6	2576	0.090	0.005	Q71JA7_DROME Nesprin OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=2 SV=1
17	M9MRD1	5.0	29.6	12345	0.111	0.001	MS300_DROME Muscle-specific protein 300 kDa OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
18	M9PC23	5.0	29.6	7962	0.090	0.002	M9PC23_DROME Muscle-specific protein 300 kDa, isoform J OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
19	M9PC84	5.0	29.6	12308	0.111	0.001	M9PC84_DROME Muscle-specific protein 300 kDa, isoform L OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1
20	M9MRD6	5.2	29.6	11999	0.111	0.001	M9MRD6_DROME Muscle-specific protein 300 kDa, isoform I OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01996 F420_ligase	2e+02	12.7	F420-0:Gamma-glutamyl ligase
2	PF11221 Med21	8.7e-21	86.2	Subunit 21 of Mediator complex
3	PF05816 TelA	47	14.5	Toxic anion resistance protein (TelA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 30611.ENSOGAP00000010043

Rank	PPI partner	STRING score	Description
1	30611.ENSOGAP00000004895	0.990	Mediator of RNA polymerase II transcription subunit 7
2	30611.ENSOGAP00000001168	0.989	Mediator of RNA polymerase II transcription subunit 6
3	30611.ENSOGAP00000005354	0.987	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
4	30611.ENSOGAP00000015160	0.986	Mediator of RNA polymerase II transcription subunit 31
5	30611.ENSOGAP00000002259	0.971	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
6	30611.ENSOGAP00000012560	0.969	Mediator complex subunit 22
7	30611.ENSOGAP00000006671	0.963	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
8	30611.ENSOGAP00000005874	0.961	Cyclin-dependent kinase 8
9	30611.ENSOGAP00000007330	0.957	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
10	30611.ENSOGAP00000008327	0.957	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
11	30611.ENSOGAP00000016724	0.956	Mediator complex subunit 29
12	30611.ENSOGAP00000001156	0.955	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
13	30611.ENSOGAP00000004027	0.951	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
14	30611.ENSOGAP00000001659	0.950	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
15	30611.ENSOGAP00000006696	0.949	Mediator of RNA polymerase II transcription subunit 13
16	30611.ENSOGAP00000009792	0.949	Mediator complex subunit 24
17	30611.ENSOGAP00000014302	0.949	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
18	30611.ENSOGAP00000021138	0.946	Mediator complex subunit 28
19	30611.ENSOGAP00000004247	0.944	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
20	30611.ENSOGAP00000000993	0.943	Cyclin C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0016740	0.997	transferase activity
GO:0140096	0.874	catalytic activity, acting on a protein
GO:0003712	0.860	transcription coregulator activity
GO:0003713	0.743	transcription coactivator activity
GO:0061630	0.650	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0050794	0.969	regulation of cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0031323	0.948	regulation of cellular metabolic process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0010468	0.947	regulation of gene expression
GO:0019219	0.944	regulation of nucleobase-containing compound metabolic process
GO:0044237	0.916	cellular metabolic process
GO:0009889	0.916	regulation of biosynthetic process
GO:0051252	0.914	regulation of RNA metabolic process
GO:0031326	0.907	regulation of cellular biosynthetic process
GO:0010556	0.906	regulation of macromolecule biosynthetic process
GO:2001141	0.898	regulation of RNA biosynthetic process
GO:0006355	0.882	regulation of DNA-templated transcription
GO:0048518	0.881	positive regulation of biological process
GO:1901360	0.773	organic cyclic compound metabolic process
GO:0006357	0.747	regulation of transcription by RNA polymerase II
GO:0048522	0.743	positive regulation of cellular process
GO:0010604	0.713	positive regulation of macromolecule metabolic process
GO:1901576	0.688	organic substance biosynthetic process
GO:0006725	0.683	cellular aromatic compound metabolic process
GO:0046483	0.681	heterocycle metabolic process
GO:0034641	0.681	cellular nitrogen compound metabolic process
GO:0009059	0.672	macromolecule biosynthetic process
GO:0006139	0.663	nucleobase-containing compound metabolic process
GO:0090304	0.640	nucleic acid metabolic process
GO:0051173	0.633	positive regulation of nitrogen compound metabolic process
GO:0045935	0.617	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.608	positive regulation of RNA metabolic process
GO:0045893	0.597	positive regulation of DNA-templated transcription
GO:0006366	0.555	transcription by RNA polymerase II
GO:0045944	0.472	positive regulation of transcription by RNA polymerase II
GO:1901564	0.433	organonitrogen compound metabolic process
GO:0043412	0.429	macromolecule modification
GO:0070647	0.415	protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0016592	0.970	mediator complex
GO:0005667	0.907	transcription regulator complex
GO:0090575	0.902	RNA polymerase II transcription regulator complex
GO:0140535	0.798	intracellular protein-containing complex
GO:1902494	0.781	catalytic complex
GO:0070847	0.778	core mediator complex
GO:1990234	0.774	transferase complex
GO:0000151	0.441	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.

[back to server]