StarFunc result for job id Q13506

User Input

>input (487 residues)
MAAALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMAS
KPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNA
REPHLKIPKCAATTCVQSLGQGKSDVVGSLALQSVGESRLWQGHHATESEHSLSPADLGS
PASPKESSEALDAAAALSVAECVERMAPTLPKSDLNEVKELLKTNKKLAKMIGHIFEMND
DDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFAL
ARQISREVTYKYTYRTTKSKCGERDELSPKRIKVEDGFPDFQDSVQTLFQQARAKSEELA
ALSSQQPEKVMAKQMEFLCNQAGYERLQHAERRLSAGLYRQSSEEHSPNGLTSDNSDGQG
ERPLNLRMPNLQNRQPHHFVVDGELSRLYPSEAKSHSSESLGILKDYPHSAFTLEKKVIK
TEPEDSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13506	1.000	1.000	1.155E-56	487	1.000	1.000	Q13506.pdb.gz	NAB1_HUMAN NGFI-A-binding protein 1 OS=Homo sapiens OX=9606 GN=NAB1 PE=1 SV=2
2	AFDB:Q15742	0.296	0.276	5.638E-26	525	0.435	0.404	Q15742.pdb.gz	NAB2_HUMAN NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1
3	AFDB:D4A4F4	0.300	0.280	6.185E-26	525	0.431	0.400	D4A4F4.pdb.gz	D4A4F4_RAT Ngfi-A binding protein 2 OS=Rattus norvegicus OX=10116 GN=Nab2 PE=1 SV=2
4	AFDB:Q59E55	0.269	0.214	4.063E-19	625	0.302	0.235	Q59E55.pdb.gz	NAB_DROME NGFI-A-binding protein homolog OS=Drosophila melanogaster OX=7227 GN=nab PE=1 SV=3
5	AFDB:Q22002	0.228	0.193	1.462E-12	582	0.279	0.234	Q22002.pdb.gz	MAB10_CAEEL NAB transcription cofactor mab-10 OS=Caenorhabditis elegans OX=6239 GN=mab-10 PE=1 SV=2
6	AFDB:Q9WTR2	0.095	0.046	2.164E-3	1291	0.175	0.066	Q9WTR2.pdb.gz	M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus OX=10090 GN=Map3k6 PE=1 SV=4
7	AFDB:Q21029	0.068	0.033	1.317E-2	1498	0.154	0.050	Q21029.pdb.gz	NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans OX=6239 GN=nsy-1 PE=1 SV=4
8	AFDB:F1QQP6	0.083	0.070	1.380E-2	683	0.131	0.094	F1QQP6.pdb.gz	F1QQP6_DANRE Bromodomain-containing 3a OS=Danio rerio OX=7955 GN=brd3 PE=1 SV=1
9	AFDB:P39880	0.099	0.054	2.638E-2	1505	0.164	0.053	P39880.pdb.gz	CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=3
10	AFDB:P70298	0.082	0.044	3.031E-2	1426	0.172	0.059	P70298.pdb.gz	CUX2_MOUSE Homeobox protein cut-like 2 OS=Mus musculus OX=10090 GN=Cux2 PE=2 SV=2
11	PDB:6zu0C	0.098	0.108	1.655	426	0.047	0.054	6zu0C.pdb.gz
12	PDB:6lthN	0.094	0.143	2.087	261	0.070	0.130	6lthN.pdb.gz	Structure of nucleosome-bound human BAF complex.
13	PDB:6id0L	0.079	0.080	3.316	475	0.074	0.076	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:7edxc	0.081	0.209	3.810	127	0.045	0.173	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:7n6g3I	0.100	0.116	3.810	401	0.060	0.072	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
16	PDB:5o9zH	0.098	0.110	4.378	413	0.035	0.041	5o9zH.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
17	PDB:1pc2A	0.066	0.157	5.030	152	0.037	0.118	1pc2A.pdb.gz
18	PDB:7nvr3	0.076	0.141	5.030	214	0.043	0.098	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
19	PDB:2kmfA	0.090	0.266	5.518	115	0.033	0.139	2kmfA.pdb.gz
20	PDB:7aqrV	0.071	0.172	5.518	140	0.031	0.107	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13506	0.0	1007	487	1.000	1.000	NAB1_HUMAN NGFI-A-binding protein 1 OS=Homo sapiens OX=9606 GN=NAB1 PE=1 SV=2
2	Q61122	0.0	901	486	0.926	0.928	NAB1_MOUSE NGFI-A-binding protein 1 OS=Mus musculus OX=10090 GN=Nab1 PE=1 SV=2
3	D4A4F4	1.20e-108	332	461	0.370	0.390	D4A4F4_RAT Ngfi-A binding protein 2 OS=Rattus norvegicus OX=10116 GN=Nab2 PE=1 SV=2
4	Q15742	1.95e-108	333	525	0.376	0.349	NAB2_HUMAN NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1
5	Q61127	6.10e-107	330	525	0.374	0.347	NAB2_MOUSE NGFI-A-binding protein 2 OS=Mus musculus OX=10090 GN=Nab2 PE=1 SV=2
6	Q59E55	3.58e-59	207	625	0.267	0.208	NAB_DROME NGFI-A-binding protein homolog OS=Drosophila melanogaster OX=7227 GN=nab PE=1 SV=3
7	Q22002	1.26e-24	109	582	0.152	0.127	MAB10_CAEEL NAB transcription cofactor mab-10 OS=Caenorhabditis elegans OX=6239 GN=mab-10 PE=1 SV=2
8	Q86UP2	0.24	36.6	1357	0.043	0.015	KTN1_HUMAN Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1
9	Q91V24	1.0	34.7	2159	0.035	0.008	ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus OX=10090 GN=Abca7 PE=1 SV=1
10	Q22099	3.7	32.7	572	0.043	0.037	SYK_CAEEL Lysine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=kars-1 PE=3 SV=1
11	O88563	6.1	32.0	1522	0.103	0.033	MRP3_RAT ATP-binding cassette sub-family C member 3 OS=Rattus norvegicus OX=10116 GN=Abcc3 PE=1 SV=1
12	Q61595	6.8	32.0	1327	0.049	0.018	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
13	A0A1L8FDW4	7.1	31.6	619	0.033	0.026	PEX5_XENLA Peroxisomal targeting signal 1 receptor OS=Xenopus laevis OX=8355 GN=pex5.S PE=1 SV=1
14	Q96SZ5	8.3	31.2	270	0.033	0.059	AEDO_HUMAN 2-aminoethanethiol dioxygenase OS=Homo sapiens OX=9606 GN=ADO PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04902 Nab1	7.9e-60	213.9	Conserved region in Nab1
2	PF04904 NCD1	1.9e-40	148.0	NAB conserved region 1 (NCD1)
3	PF04905 NCD2	1.5e-52	188.3	NAB conserved region 2 (NCD2)
4	PF18349 PAZ_4	86	14.5	PAZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010378056.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010380591.1	0.937	Zinc finger protein 362
2	61622.XP_010386403.1	0.884	Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death.
3	61622.XP_010373861.1	0.817	Cell division cycle 73
4	61622.XP_010376093.1	0.817	Canopy FGF signaling regulator 2
5	61622.XP_010353444.1	0.733	Early growth response 2
6	61622.XP_010363688.1	0.723	Early growth response protein 3 isoform X1
7	61622.XP_010360268.1	0.687	Early growth response 4
8	61622.XP_010366456.1	0.655	Canopy FGF signaling regulator 1
9	61622.XP_010378054.1	0.642	Major facilitator superfamily domain containing 6
10	61622.XP_010384237.1	0.594	chromodomain-helicase-DNA-binding protein 4 isoform X1
11	61622.XP_010355710.1	0.533	chromodomain-helicase-DNA-binding protein 5
12	61622.XP_010358410.1	0.533	Autoimmune regulator
13	61622.XP_010360702.1	0.533	chromodomain-helicase-DNA-binding protein 3 isoform X1
14	61622.XP_010366763.1	0.533	PHD finger protein 21B
15	61622.XP_010369354.1	0.533	PHD finger protein 21A isoform X1
16	61622.XP_010376510.1	0.525	Transcription elongation regulator 1 isoform X1
17	61622.XP_010379877.1	0.525	Proteasome subunit alpha type-2
18	61622.XP_010354964.1	0.523	Belongs to the MCM family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003712	1.000	transcription coregulator activity
GO:0003714	0.848	transcription corepressor activity
GO:0042802	0.798	identical protein binding
GO:0003677	0.438	DNA binding
GO:0003700	0.355	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.990	developmental process
GO:0050789	0.990	regulation of biological process
GO:0009987	0.988	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0048856	0.972	anatomical structure development
GO:0060255	0.956	regulation of macromolecule metabolic process
GO:0032501	0.955	multicellular organismal process
GO:0051171	0.954	regulation of nitrogen compound metabolic process
GO:0080090	0.953	regulation of primary metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0007275	0.943	multicellular organism development
GO:0010556	0.939	regulation of macromolecule biosynthetic process
GO:0031326	0.939	regulation of cellular biosynthetic process
GO:0019219	0.939	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.898	regulation of gene expression
GO:0048731	0.896	system development
GO:0051252	0.896	regulation of RNA metabolic process
GO:0006355	0.889	regulation of DNA-templated transcription
GO:0048513	0.560	animal organ development
GO:0030154	0.499	cell differentiation
GO:0007399	0.474	nervous system development
GO:0048519	0.460	negative regulation of biological process
GO:0009653	0.404	anatomical structure morphogenesis
GO:0050793	0.383	regulation of developmental process
GO:0048523	0.365	negative regulation of cellular process
GO:0042552	0.339	myelination
GO:0007422	0.326	peripheral nervous system development
GO:0048518	0.302	positive regulation of biological process
GO:0036075	0.300	replacement ossification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.712	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]