StarFunc result for job id Q13507

User Input

>input (836 residues)
MREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDY
MGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKR
LTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDY
FCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIE
KEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLA
IKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPC
SRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTT
QFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFL
QATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAVVLSFSR
IAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFT
TVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMINS
SYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFIMRIVNFPKCRRR
RLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMKRLIKRYVLKAQV
DKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSMLRCE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G1U2U3	0.962	0.813	6.734E-92	991	0.988	0.834	G1U2U3.pdb.gz	G1U2U3_RABIT Transient receptor potential cation channel subfamily C member 3 OS=Oryctolagus cuniculus OX=9986 GN=TRPC3 PE=1 SV=2
2	AFDB:F1LQF7	0.948	0.920	6.360E-86	862	0.812	0.788	F1LQF7.pdb.gz	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
3	AFDB:Q9Y210	0.908	0.817	1.566E-79	931	0.743	0.667	Q9Y210.pdb.gz	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
4	PDB:7dxbA	0.851	0.961	1.023E-76	738	0.880	0.997	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
5	PDB:6uz8A	0.836	0.949	9.854E-65	734	0.700	0.797	6uz8A.pdb.gz	Structural basis for pharmacological modulation of the TRPC6 channel.
6	PDB:7dxgA	0.797	0.950	1.617E-63	698	0.675	0.808	7dxgA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
7	PDB:5zbgA	0.772	0.958	2.846E-60	670	0.793	0.990	5zbgA.pdb.gz
8	PDB:5yx9A	0.768	0.944	1.028E-53	675	0.663	0.821	5yx9A.pdb.gz
9	AFDB:O35119	0.783	0.674	1.913E-45	977	0.376	0.321	O35119.pdb.gz	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
10	AFDB:Q9QX29	0.784	0.675	1.913E-45	975	0.378	0.324	Q9QX29.pdb.gz	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
11	AFDB:A0A0R4IM91	0.785	0.720	2.917E-45	915	0.372	0.340	A0A0R4IM91.pdb.gz	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
12	AFDB:Q9VJJ7	0.794	0.595	3.262E-44	1128	0.385	0.285	Q9VJJ7.pdb.gz	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
13	AFDB:E1U7G1	0.781	0.819	1.813E-40	796	0.327	0.343	E1U7G1.pdb.gz	E1U7G1_DANRE Short transient receptor potential channel 1 OS=Danio rerio OX=7955 GN=trpc1 PE=2 SV=1
14	AFDB:Q9R244	0.791	0.572	1.813E-40	1172	0.339	0.241	Q9R244.pdb.gz	TRPC2_MOUSE Short transient receptor potential channel 2 OS=Mus musculus OX=10090 GN=Trpc2 PE=2 SV=2
15	AFDB:P48995	0.776	0.816	2.463E-40	793	0.330	0.348	P48995.pdb.gz	TRPC1_HUMAN Short transient receptor potential channel 1 OS=Homo sapiens OX=9606 GN=TRPC1 PE=1 SV=1
16	PDB:7b0jA	0.712	0.867	1.619E-39	682	0.355	0.435	7b0jA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
17	PDB:7b1gA	0.719	0.864	3.333E-37	691	0.366	0.443	7b1gA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
18	PDB:6ysnA	0.639	0.875	5.214E-33	606	0.319	0.441	6ysnA.pdb.gz	Human TRPC5 structures reveal interaction of a xanthine-based TRPC1/4/5 inhibitor with a conserved lipid binding site.
19	PDB:7a6uA	0.312	0.771	3.191E-23	332	0.282	0.711	7a6uA.pdb.gz
20	PDB:5vkqA	0.413	0.245	3.131E-17	1499	0.183	0.102	5vkqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IM91	546	915	0.376	0.343	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
2	A0A8I6ATX7	1338	800	0.783	0.819	A0A8I6ATX7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
3	A0A8I6GIE6	1281	807	0.762	0.789	A0A8I6GIE6_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
4	A0A8I6GIF7	1251	801	0.739	0.772	A0A8I6GIF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=1
5	F1LQF7	1416	862	0.819	0.795	F1LQF7_RAT Transient receptor potential cation channel, subfamily C, member 7 OS=Rattus norvegicus OX=10116 GN=Trpc7 PE=4 SV=2
6	F7EUD8	529	406	0.304	0.626	F7EUD8_RAT Transient receptor ion channel domain-containing protein OS=Rattus norvegicus OX=10116 GN=Trpc6 PE=1 SV=1
7	G1U2U3	1710	991	0.988	0.834	G1U2U3_RABIT Transient receptor potential cation channel subfamily C member 3 OS=Oryctolagus cuniculus OX=9986 GN=TRPC3 PE=1 SV=2
8	Q13507	1729	921	1.000	0.908	TRPC3_HUMAN Short transient receptor potential channel 3 OS=Homo sapiens OX=9606 GN=TRPC3 PE=1 SV=4
9	Q61143	1290	930	0.750	0.674	TRPC6_MOUSE Short transient receptor potential channel 6 OS=Mus musculus OX=10090 GN=Trpc6 PE=1 SV=3
10	Q8VD38	565	974	0.386	0.332	Q8VD38_RAT Transient receptor potential cation channel subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=2 SV=1
11	Q99N78	1288	930	0.746	0.671	Q99N78_RAT Transient receptor potential Ca2+ channel 6A OS=Rattus norvegicus OX=10116 GN=Trpc6 PE=1 SV=1
12	Q9HCX4	1414	862	0.817	0.792	TRPC7_HUMAN Short transient receptor potential channel 7 OS=Homo sapiens OX=9606 GN=TRPC7 PE=1 SV=1
13	Q9JMI9	1668	909	0.964	0.887	TRPC3_RAT Short transient receptor potential channel 3 OS=Rattus norvegicus OX=10116 GN=Trpc3 PE=2 SV=4
14	Q9QX29	564	975	0.386	0.331	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
15	Q9QZC1	1670	910	0.965	0.887	TRPC3_MOUSE Short transient receptor potential channel 3 OS=Mus musculus OX=10090 GN=Trpc3 PE=1 SV=2
16	Q9UL62	560	973	0.382	0.328	TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens OX=9606 GN=TRPC5 PE=1 SV=1
17	Q9VJJ7	562	1128	0.386	0.286	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
18	Q9WVC5	1415	862	0.819	0.795	TRPC7_MOUSE Short transient receptor potential channel 7 OS=Mus musculus OX=10090 GN=Trpc7 PE=2 SV=1
19	Q9Y210	1288	931	0.746	0.670	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
20	U3N7D8	546	915	0.376	0.343	U3N7D8_DANRE Transient receptor potential cation channel subfamily c member 4a OS=Danio rerio OX=7955 GN=trpc4a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1	21.1	Ankyrin repeat
2	PF12796 Ank_2	1.2e-06	40.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.022	26.1	Ankyrin repeat
4	PF13637 Ank_4	0.014	27.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.023	26.3	Ankyrin repeats (many copies)
6	PF12998 ING	8.2e+02	12.0	Inhibitor of growth proteins N-terminal histone-binding
7	PF00520 Ion_trans	2e-29	114.1	Ion transport protein
8	PF14551 MCM_N	2.1e+02	13.9	MCM N-terminal domain
9	PF08016 PKD_channel	2.7e-09	48.3	Polycystin cation channel
10	PF08344 TRP_2	2.1e-23	93.6	Transient receptor ion channel II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000000064

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000016112	0.886	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
2	60711.ENSCSAP00000000466	0.864	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
3	60711.ENSCSAP00000002926	0.864	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
4	60711.ENSCSAP00000015316	0.839	Transient receptor potential cation channel, subfamily V, member 4
5	60711.ENSCSAP00000000604	0.826	Stromal interaction molecule 1
6	60711.ENSCSAP00000010095	0.817	Phospholipase C, gamma 1
7	60711.ENSCSAP00000008363	0.816	NPHS2, podocin
8	60711.ENSCSAP00000005896	0.805	Inositol 1,4,5-trisphosphate receptor, type 3
9	60711.ENSCSAP00000006711	0.805	Bone morphogenetic protein receptor, type II (serine/threonine kinase)
10	60711.ENSCSAP00000007155	0.805	Inositol 1,4,5-trisphosphate receptor, type 1
11	60711.ENSCSAP00000008266	0.804	RAR-related orphan receptor A
12	60711.ENSCSAP00000004254	0.800	K(lysine) acetyltransferase 5
13	60711.ENSCSAP00000005826	0.784	Transient receptor potential cation channel, subfamily M, member 5
14	60711.ENSCSAP00000003956	0.783	Inositol 1,4,5-trisphosphate receptor, type 2
15	60711.ENSCSAP00000015390	0.761	Transient receptor potential cation channel, subfamily M, member 4
16	60711.ENSCSAP00000010228	0.745	Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release channels.
17	60711.ENSCSAP00000000658	0.739	NPHS1, nephrin
18	60711.ENSCSAP00000009773	0.731	Belongs to the transient receptor (TC 1.A.4) family.
19	60711.ENSCSAP00000005072	0.720	Transient receptor potential cation channel, subfamily V, member 2
20	60711.ENSCSAP00000009766	0.715	Transient receptor potential cation channel, subfamily A, member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005261	0.998	monoatomic cation channel activity
GO:0015085	0.989	calcium ion transmembrane transporter activity
GO:0005262	0.980	calcium channel activity
GO:0043167	0.854	ion binding
GO:0043168	0.797	anion binding
GO:0070679	0.418	inositol 1,4,5 trisphosphate binding
GO:0015279	0.363	store-operated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0006816	0.974	calcium ion transport
GO:0070588	0.947	calcium ion transmembrane transport
GO:0065007	0.946	biological regulation
GO:0050789	0.907	regulation of biological process
GO:0050794	0.727	regulation of cellular process
GO:0050896	0.641	response to stimulus
GO:0048518	0.634	positive regulation of biological process
GO:0065008	0.454	regulation of biological quality
GO:0048522	0.401	positive regulation of cellular process
GO:0051716	0.308	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043229	0.997	intracellular organelle
GO:0043227	0.996	membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005886	0.985	plasma membrane
GO:0012505	0.983	endomembrane system
GO:0005801	0.731	cis-Golgi network
GO:0048471	0.473	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.989	Ca(2+)(in) = Ca(2+)(out)

[back to server]