StarFunc result for job id Q13510

User Input

>input (395 residues)
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYK
RWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITE
QLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWI
LGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKE
SLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLST
KPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13510	1.000	1.000	4.979E-88	395	1.000	1.000	Q13510.pdb.gz	ASAH1_HUMAN Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1 PE=1 SV=5
2	AFDB:Q6P7S1	0.938	0.940	2.168E-74	394	0.825	0.827	Q6P7S1.pdb.gz	ASAH1_RAT Acid ceramidase OS=Rattus norvegicus OX=10116 GN=Asah1 PE=1 SV=1
3	AFDB:Q6PH71	0.936	0.936	1.431E-66	395	0.597	0.597	Q6PH71.pdb.gz	Q6PH71_DANRE ceramidase OS=Danio rerio OX=7955 GN=zgc:66026 PE=2 SV=1
4	AFDB:Q5KTC7	0.773	0.842	2.795E-38	362	0.306	0.334	Q5KTC7.pdb.gz	NAAA_RAT N-acylethanolamine-hydrolyzing acid amidase OS=Rattus norvegicus OX=10116 GN=Naaa PE=1 SV=1
5	AFDB:Q02083	0.749	0.821	2.714E-37	359	0.281	0.309	Q02083.pdb.gz	NAAA_HUMAN N-acylethanolamine-hydrolyzing acid amidase OS=Homo sapiens OX=9606 GN=NAAA PE=1 SV=3
6	PDB:6dxwA	0.759	0.907	8.169E-36	328	0.286	0.345	6dxwA.pdb.gz
7	AFDB:C8V264	0.634	0.716	4.978E-17	345	0.162	0.186	C8V264.pdb.gz	C8V264_EMENI Acyl-CoA:6-aminopenicillanic-acid-acyltransferase, putative (AFU_orthologue AFUA_3G12620) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06775 PE=4 SV=1
8	AFDB:B6HLT9	0.605	0.662	1.697E-15	357	0.147	0.162	B6HLT9.pdb.gz	AATA_PENRW Isopenicillin-N N-acyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=aatA PE=1 SV=1
9	AFDB:P21133	0.603	0.661	8.040E-15	357	0.137	0.151	P21133.pdb.gz	AATA_EMENI Acyl-coenzyme A:6-aminopenicillanic-acid-acyltransferase 40 kDa form OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=penDE PE=1 SV=1
10	PDB:2x1cB	0.619	0.680	9.571E-15	356	0.142	0.157	2x1cB.pdb.gz
11	AFDB:Q9W369	0.588	0.599	1.648E-14	387	0.144	0.147	Q9W369.pdb.gz	TANN_DROME Beta-alanyl-dopamine/carcinine hydrolase OS=Drosophila melanogaster OX=7227 GN=t PE=1 SV=1
12	AFDB:Q6P4A8	0.450	0.339	6.540E-8	553	0.101	0.072	Q6P4A8.pdb.gz	PLBL1_HUMAN Phospholipase B-like 1 OS=Homo sapiens OX=9606 GN=PLBD1 PE=1 SV=2
13	PDB:3fgwA	0.457	0.353	1.550E-6	529	0.101	0.076	3fgwA.pdb.gz
14	PDB:5fgiN	0.305	0.506	9.611E-5	213	0.101	0.188	5fgiN.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
15	PDB:4r3oK	0.288	0.486	1.296E-4	199	0.061	0.121	4r3oK.pdb.gz
16	PDB:1z7qF	0.259	0.386	1.376E-4	234	0.071	0.120	1z7qF.pdb.gz
17	PDB:3e47J	0.285	0.492	2.503E-4	198	0.058	0.116	3e47J.pdb.gz	Inhibitor-binding mode of homobelactosin C to proteasomes: new insights into class I MHC ligand generation
18	PDB:8cvsL	0.293	0.486	2.821E-4	213	0.071	0.131	8cvsL.pdb.gz	Structural insights into the human PA28-20S proteasome enabled by efficient tagging and purification of endogenous proteins.
19	PDB:1q5rH	0.274	0.399	8.280E-4	251	0.091	0.143	1q5rH.pdb.gz
20	PDB:5fgiH	0.293	0.446	9.907E-4	234	0.066	0.111	5fgiH.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13510	0.0	820	395	1.000	1.000	ASAH1_HUMAN Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1 PE=1 SV=5
2	Q6P7S1	0.0	698	394	0.825	0.827	ASAH1_RAT Acid ceramidase OS=Rattus norvegicus OX=10116 GN=Asah1 PE=1 SV=1
3	Q6PH71	0.0	538	395	0.597	0.597	Q6PH71_DANRE ceramidase OS=Danio rerio OX=7955 GN=zgc:66026 PE=2 SV=1
4	Q9WV54	0.0	683	394	0.792	0.794	ASAH1_MOUSE Acid ceramidase OS=Mus musculus OX=10090 GN=Asah1 PE=1 SV=1
5	Q9D7V9	2.06e-61	204	362	0.304	0.331	NAAA_MOUSE N-acylethanolamine-hydrolyzing acid amidase OS=Mus musculus OX=10090 GN=Naaa PE=1 SV=2
6	Q5KTC7	1.15e-60	202	362	0.306	0.334	NAAA_RAT N-acylethanolamine-hydrolyzing acid amidase OS=Rattus norvegicus OX=10116 GN=Naaa PE=1 SV=1
7	Q02083	7.84e-57	192	359	0.294	0.323	NAAA_HUMAN N-acylethanolamine-hydrolyzing acid amidase OS=Homo sapiens OX=9606 GN=NAAA PE=1 SV=3
8	A2VEC9	0.67	35.0	5150	0.043	0.003	SSPO_HUMAN SCO-spondin OS=Homo sapiens OX=9606 GN=SSPOP PE=2 SV=2
9	Q7JPE3	5.9	31.6	1212	0.078	0.026	Q7JPE3_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03417 AAT	1.7	19.7	Acyl-coenzyme A:6-aminopenicillanic acid acyl-transferase
2	PF02275 CBAH	3.4e-56	202.8	Linear amide C-N hydrolases, choloylglycine hydrolase family
3	PF04367 DUF502	3.6e+02	12.5	Protein of unknown function (DUF502)
4	PF01856 HP_OMP	2.6e+02	13.0	Helicobacter outer membrane protein
5	PF15508 NAAA-beta	4.8e-18	76.5	beta subunit of N-acylethanolamine-hydrolyzing acid amidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000034295

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000052717	0.998	Uncharacterized protein
2	9598.ENSPTRP00000019290	0.985	Sphingosine kinase 2
3	9598.ENSPTRP00000025025	0.963	Ceramide kinase
4	9598.ENSPTRP00000035782	0.957	Non-lysosomal glucosylceramidase
5	9598.ENSPTRP00000017122	0.954	3-ketodihydrosphingosine reductase
6	9598.ENSPTRP00000036316	0.952	UDP-glucose ceramide glucosyltransferase
7	9598.ENSPTRP00000004317	0.944	Sphingomyelin synthase 1
8	9598.ENSPTRP00000003391	0.938	Chromosome 5 open reading frame 24
9	9598.ENSPTRP00000028918	0.936	Uncharacterized protein
10	9598.ENSPTRP00000011226	0.932	Uncharacterized protein
11	9598.ENSPTRP00000051730	0.932	Glucosylceramidase
12	9598.ENSPTRP00000041167	0.931	Uncharacterized protein
13	9598.ENSPTRP00000022169	0.928	Sphingosine-1-phosphate phosphatase 2
14	9598.ENSPTRP00000011449	0.926	Delta(4)-desaturase, sphingolipid 2
15	9598.ENSPTRP00000028145	0.920	Uncharacterized protein
16	9598.ENSPTRP00000007035	0.919	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid
17	9598.ENSPTRP00000017621	0.919	Alkaline ceramidase
18	9598.ENSPTRP00000060390	0.912	Uncharacterized protein
19	9598.ENSPTRP00000040261	0.911	Uncharacterized protein
20	9598.ENSPTRP00000004313	0.910	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017040	1.000	N-acylsphingosine amidohydrolase activity
GO:0008134	0.945	transcription factor binding
GO:0140297	0.936	DNA-binding transcription factor binding
GO:0003712	0.758	transcription coregulator activity
GO:0003714	0.706	transcription corepressor activity
GO:0061629	0.689	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.680	nuclear receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0043603	0.990	amide metabolic process
GO:0006665	0.990	sphingolipid metabolic process
GO:1901576	0.985	organic substance biosynthetic process
GO:0044248	0.985	cellular catabolic process
GO:1901575	0.984	organic substance catabolic process
GO:0044281	0.979	small molecule metabolic process
GO:0034311	0.967	diol metabolic process
GO:0046519	0.967	sphingoid metabolic process
GO:0006672	0.965	ceramide metabolic process
GO:0044249	0.957	cellular biosynthetic process
GO:1901565	0.955	organonitrogen compound catabolic process
GO:0046467	0.948	membrane lipid biosynthetic process
GO:0016042	0.939	lipid catabolic process
GO:0046466	0.921	membrane lipid catabolic process
GO:1901566	0.919	organonitrogen compound biosynthetic process
GO:0032502	0.916	developmental process
GO:0046173	0.911	polyol biosynthetic process
GO:0030148	0.889	sphingolipid biosynthetic process
GO:0034312	0.882	diol biosynthetic process
GO:0030149	0.868	sphingolipid catabolic process
GO:0065007	0.837	biological regulation
GO:0050789	0.812	regulation of biological process
GO:0034641	0.803	cellular nitrogen compound metabolic process
GO:0050794	0.656	regulation of cellular process
GO:0048856	0.636	anatomical structure development
GO:0044271	0.636	cellular nitrogen compound biosynthetic process
GO:0050896	0.389	response to stimulus
GO:0046513	0.336	ceramide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0070013	0.993	intracellular organelle lumen
GO:0005576	0.975	extracellular region
GO:0031982	0.963	vesicle
GO:0000323	0.946	lytic vacuole
GO:0031410	0.937	cytoplasmic vesicle
GO:0005764	0.925	lysosome
GO:0070062	0.921	extracellular exosome
GO:0016020	0.865	membrane
GO:0099503	0.779	secretory vesicle
GO:0030141	0.764	secretory granule
GO:0005775	0.705	vacuolar lumen
GO:0043202	0.640	lysosomal lumen
GO:0101002	0.556	ficolin-1-rich granule
GO:0070820	0.512	tertiary granule
GO:1904813	0.413	ficolin-1-rich granule lumen
GO:0031981	0.368	nuclear lumen
GO:1904724	0.325	tertiary granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20856	1.000	an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine
EC:3.5.1.23	1.000	ceramidase.

[back to server]