StarFunc result for job id Q13515

User Input

>input (415 residues)
MSERRVVVDLPTSASSSMPLQRRRASFRGPRSSSSLESPPASRTNAMSGLVRAPGVYVGT
APSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMA
KVHALEQVSQELETQLRMHLESKATRSGNWGALRASWASSCQQVGEAVLENARLMLQTET
IQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRN
YEEDVKLLHKQLAGCELEQMDAPIGTGLDDILETIRIQWERDVEKNRVEAGALLQAKQQA
EVAHMSQTQEEKLAAALRVELHNTSCQVQSLQAETESLRALKRGLENTLHDAKHWHDMEL
QNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREESG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13515	1.000	1.000	1.198E-57	415	1.000	1.000	Q13515.pdb.gz	BFSP2_HUMAN Phakinin OS=Homo sapiens OX=9606 GN=BFSP2 PE=1 SV=1
2	AFDB:Q6NVD9	0.742	0.741	1.301E-47	416	0.846	0.844	Q6NVD9.pdb.gz	BFSP2_MOUSE Phakinin OS=Mus musculus OX=10090 GN=Bfsp2 PE=1 SV=1
3	AFDB:A0A024RAY2	0.329	0.319	4.853E-14	430	0.318	0.307	A0A024RAY2.pdb.gz
4	AFDB:Q6PVZ1	0.319	0.292	2.695E-13	467	0.296	0.263	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
5	AFDB:P19012	0.365	0.339	4.215E-13	456	0.304	0.276	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
6	AFDB:Q64291	0.437	0.385	1.497E-12	487	0.296	0.253	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
7	AFDB:Q6IFV1	0.469	0.412	2.173E-12	485	0.284	0.243	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
8	AFDB:Q99456	0.363	0.316	2.173E-12	494	0.316	0.265	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
9	AFDB:P02533	0.415	0.377	2.341E-12	472	0.304	0.267	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
10	AFDB:Q61414	0.411	0.385	2.341E-12	452	0.296	0.272	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
11	PDB:8at3A	0.135	0.169	8.088	286	0.104	0.150	8at3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13515	0.0	841	415	1.000	1.000	BFSP2_HUMAN Phakinin OS=Homo sapiens OX=9606 GN=BFSP2 PE=1 SV=1
2	Q6NVD9	0.0	702	416	0.846	0.844	BFSP2_MOUSE Phakinin OS=Mus musculus OX=10090 GN=Bfsp2 PE=1 SV=1
3	F8VZY9	1.88e-52	182	391	0.313	0.332	F8VZY9_HUMAN Keratin 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=1
4	P05783	5.18e-52	182	430	0.313	0.302	K1C18_HUMAN Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2
5	P05784	9.93e-47	167	423	0.294	0.288	K1C18_MOUSE Keratin, type I cytoskeletal 18 OS=Mus musculus OX=10090 GN=Krt18 PE=1 SV=5
6	Q5BJY9	2.17e-45	164	423	0.287	0.281	K1C18_RAT Keratin, type I cytoskeletal 18 OS=Rattus norvegicus OX=10116 GN=Krt18 PE=1 SV=3
7	Q6IFV4	9.72e-45	162	438	0.275	0.260	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
8	P08730	5.81e-44	160	437	0.270	0.256	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
9	A1A4E9	3.05e-43	159	458	0.248	0.225	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
10	P13646	3.45e-43	159	458	0.248	0.225	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
11	P19001	5.92e-43	157	403	0.277	0.285	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
12	K7ERE3	9.18e-43	157	415	0.248	0.248	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
13	Q61781	1.25e-42	158	484	0.253	0.217	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
14	Q61414	1.75e-42	157	452	0.253	0.232	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
15	Q6IFV1	6.98e-42	155	485	0.251	0.214	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
16	P08727	1.09e-41	153	400	0.248	0.258	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
17	Q6IFU8	1.16e-41	154	433	0.248	0.238	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
18	Q9QWL7	1.49e-41	154	433	0.248	0.238	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
19	Q9Z2K1	2.04e-41	154	469	0.260	0.230	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
20	P02533	2.21e-41	154	472	0.251	0.220	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04108 ATG17_like	7e+02	11.0	Autophagy protein ATG17-like domain
2	PF06103 DUF948	4.6e+02	12.5	Bacterial protein of unknown function (DUF948)
3	PF00038 Filament	7.2e-50	182.0	Intermediate filament protein
4	PF03954 Lectin_N	1.4e+02	13.7	Hepatic lectin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304987

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367104	0.995	Filensin
2	9606.ENSP00000354554	0.964	Cytochrome b
3	9606.ENSP00000264009	0.875	Heat shock factor protein 4
4	9606.ENSP00000215939	0.862	Beta-crystallin B1
5	9606.ENSP00000257979	0.855	Lens fiber major intrinsic protein
6	9606.ENSP00000241125	0.843	Gap junction alpha-3 protein
7	9606.ENSP00000358238	0.828	Gap junction alpha-8 protein
8	9606.ENSP00000381273	0.822	Beta-crystallin B2
9	9606.ENSP00000376287	0.819	Beta-crystallin S
10	9606.ENSP00000291554	0.809	Crystallin, alpha A
11	9606.ENSP00000482816	0.809	Alpha-crystallin A chain
12	9606.ENSP00000225387	0.795	Beta-crystallin A3
13	9606.ENSP00000346805	0.794	Beta-crystallin A4
14	9606.ENSP00000264376	0.791	Gamma-crystallin D
15	9606.ENSP00000359691	0.784	Lengsin
16	9606.ENSP00000215855	0.749	Beta-crystallin B3
17	9606.ENSP00000217402	0.746	Charged multivesicular body protein 4b
18	9606.ENSP00000221973	0.744	Lens intrinsic membrane protein 2
19	9606.ENSP00000433560	0.734	Alpha-crystallin B chain
20	9606.ENSP00000259365	0.729	Tropomodulin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	1.000	protein binding
GO:0005200	0.929	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.984	multicellular organismal process
GO:0032502	0.978	developmental process
GO:0048856	0.974	anatomical structure development
GO:0045103	0.940	intermediate filament-based process
GO:0007275	0.822	multicellular organism development
GO:0048513	0.728	animal organ development
GO:0016043	0.718	cellular component organization
GO:0048731	0.713	system development
GO:0009888	0.703	tissue development
GO:0006996	0.677	organelle organization
GO:0048880	0.595	sensory system development
GO:0030855	0.595	epithelial cell differentiation
GO:0045104	0.513	intermediate filament cytoskeleton organization
GO:0001654	0.501	eye development
GO:0002088	0.489	lens development in camera-type eye
GO:0070306	0.405	lens fiber cell differentiation
GO:0097435	0.399	supramolecular fiber organization
GO:0021700	0.332	developmental maturation
GO:0065007	0.316	biological regulation
GO:0050789	0.302	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005856	0.999	cytoskeleton
GO:0099080	0.989	supramolecular complex
GO:0005882	0.981	intermediate filament
GO:0016020	0.892	membrane
GO:0005737	0.824	cytoplasm
GO:0071944	0.400	cell periphery
GO:0005886	0.383	plasma membrane
GO:0043227	0.364	membrane-bounded organelle
GO:0005829	0.308	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]