StarFunc result for job id Q13526

User Input

>input (163 residues)
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0BNL2	0.988	0.977	2.796E-34	165	0.969	0.958	B0BNL2.pdb.gz	B0BNL2_RAT Peptidyl-prolyl cis-trans isomerase OS=Rattus norvegicus OX=10116 GN=Pin1 PE=2 SV=1
2	AFDB:Q9I9K6	0.957	0.981	6.057E-32	159	0.865	0.887	Q9I9K6.pdb.gz	Q9I9K6_XENLA Peptidyl-prolyl cis-trans isomerase OS=Xenopus laevis OX=8355 GN=pin1.L PE=1 SV=1
3	AFDB:Q6PBX1	0.943	0.967	4.419E-30	159	0.779	0.799	Q6PBX1.pdb.gz	Q6PBX1_DANRE Peptidyl-prolyl cis-trans isomerase OS=Danio rerio OX=7955 GN=zgc:73206 PE=1 SV=1
4	PDB:1nmvA	0.675	0.675	7.274E-28	163	1.000	1.000	1nmvA.pdb.gz
5	AFDB:P54353	0.731	0.718	5.791E-24	166	0.558	0.548	P54353.pdb.gz	DOD_DROME Putative peptidyl-prolyl cis-trans isomerase dodo OS=Drosophila melanogaster OX=7227 GN=dod PE=2 SV=3
6	AFDB:K7EMU7	0.757	0.848	7.499E-23	145	0.785	0.883	K7EMU7.pdb.gz	K7EMU7_HUMAN Peptidyl-prolyl cis-trans isomerase OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1
7	AFDB:C8V2B0	0.675	0.626	2.380E-21	176	0.503	0.466	C8V2B0.pdb.gz	C8V2B0_EMENI Peptidyl-prolyl cis-trans isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06145 PE=4 SV=1
8	AFDB:O74448	0.670	0.625	1.180E-20	175	0.503	0.469	O74448.pdb.gz	PIN1_SCHPO Peptidyl-prolyl cis-trans isomerase pin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pin1 PE=4 SV=1
9	AFDB:P22696	0.674	0.646	3.744E-19	170	0.442	0.424	P22696.pdb.gz	ESS1_YEAST Peptidyl-prolyl cis-trans isomerase ESS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESS1 PE=1 SV=3
10	AFDB:Q59KZ2	0.684	0.631	1.436E-18	177	0.442	0.407	Q59KZ2.pdb.gz	Q59KZ2_CANAL Peptidyl-prolyl cis-trans isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ESS1 PE=1 SV=1
11	PDB:1yw5A	0.675	0.622	1.821E-18	177	0.442	0.407	1yw5A.pdb.gz
12	PDB:7kkfA	0.662	0.666	4.463E-18	162	0.448	0.451	7kkfA.pdb.gz
13	AFDB:Q55EZ0	0.733	0.454	1.864E-16	268	0.436	0.265	Q55EZ0.pdb.gz	Q55EZ0_DICDI Peptidyl-prolyl cis-trans isomerase OS=Dictyostelium discoideum OX=44689 GN=pinA PE=4 SV=1
14	PDB:2lj4A	0.631	0.875	1.970E-12	115	0.350	0.496	2lj4A.pdb.gz
15	PDB:1j6yA	0.576	0.752	9.222E-9	120	0.368	0.500	1j6yA.pdb.gz
16	PDB:1m5yD	0.585	0.251	3.327E-7	389	0.215	0.090	1m5yD.pdb.gz
17	PDB:1jnsA	0.457	0.748	3.564E-5	92	0.221	0.391	1jnsA.pdb.gz
18	PDB:6drtA	0.145	0.118	7.757E-1	230	0.055	0.039	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
19	PDB:2z4hB	0.135	0.116	1.380	194	0.049	0.041	2z4hB.pdb.gz
20	PDB:2mphA	0.219	0.167	2.456	224	0.123	0.089	2mphA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13526	2.09e-120	338	163	1.000	1.000	PIN1_HUMAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1
2	B0BNL2	2.05e-114	323	165	0.969	0.958	B0BNL2_RAT Peptidyl-prolyl cis-trans isomerase OS=Rattus norvegicus OX=10116 GN=Pin1 PE=2 SV=1
3	Q9QUR7	1.35e-109	310	165	0.963	0.952	PIN1_MOUSE Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Mus musculus OX=10090 GN=Pin1 PE=1 SV=1
4	Q3ULQ2	6.96e-106	301	159	0.920	0.943	Q3ULQ2_MOUSE Peptidyl-prolyl cis-trans isomerase OS=Mus musculus OX=10090 GN=Pin1rt1 PE=1 SV=1
5	Q9I9K6	1.71e-104	297	159	0.871	0.893	Q9I9K6_XENLA Peptidyl-prolyl cis-trans isomerase OS=Xenopus laevis OX=8355 GN=pin1.L PE=1 SV=1
6	A0A8I6AJH7	5.01e-100	286	153	0.865	0.922	A0A8I6AJH7_RAT Peptidyl-prolyl cis-trans isomerase OS=Rattus norvegicus OX=10116 GN=Pin1 PE=1 SV=1
7	F7EW79	1.59e-99	285	162	0.859	0.864	F7EW79_RAT Peptidyl-prolyl cis-trans isomerase OS=Rattus norvegicus OX=10116 GN=Pin1 PE=1 SV=1
8	A0A8I6AB19	1.99e-96	277	156	0.859	0.897	A0A8I6AB19_RAT Peptidyl-prolyl cis-trans isomerase OS=Rattus norvegicus OX=10116 GN=Pin1 PE=1 SV=1
9	Q6PBX1	1.02e-93	270	159	0.785	0.805	Q6PBX1_DANRE Peptidyl-prolyl cis-trans isomerase OS=Danio rerio OX=7955 GN=zgc:73206 PE=1 SV=1
10	K7EMU7	2.02e-91	264	145	0.785	0.883	K7EMU7_HUMAN Peptidyl-prolyl cis-trans isomerase OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1
11	P54353	1.99e-55	174	166	0.558	0.548	DOD_DROME Putative peptidyl-prolyl cis-trans isomerase dodo OS=Drosophila melanogaster OX=7227 GN=dod PE=2 SV=3
12	A0A8I6GJ67	1.43e-51	164	183	0.528	0.470	A0A8I6GJ67_RAT Peptidylprolyl cis/trans isomerase, NIMA-interacting 1 OS=Rattus norvegicus OX=10116 GN=Pin1 PE=1 SV=1
13	C8V2B0	1.95e-46	151	176	0.503	0.466	C8V2B0_EMENI Peptidyl-prolyl cis-trans isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06145 PE=4 SV=1
14	O74448	7.73e-46	149	175	0.497	0.463	PIN1_SCHPO Peptidyl-prolyl cis-trans isomerase pin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pin1 PE=4 SV=1
15	Q59KZ2	1.01e-43	144	177	0.448	0.412	Q59KZ2_CANAL Peptidyl-prolyl cis-trans isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ESS1 PE=1 SV=1
16	P22696	2.54e-42	140	170	0.466	0.447	ESS1_YEAST Peptidyl-prolyl cis-trans isomerase ESS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESS1 PE=1 SV=3
17	Q55EZ0	2.62e-39	135	268	0.417	0.254	Q55EZ0_DICDI Peptidyl-prolyl cis-trans isomerase OS=Dictyostelium discoideum OX=44689 GN=pinA PE=4 SV=1
18	Q9SL42	4.19e-35	120	119	0.356	0.487	PIN1_ARATH Peptidyl-prolyl cis-trans isomerase Pin1 OS=Arabidopsis thaliana OX=3702 GN=PIN1 PE=1 SV=1
19	Q4UG71	9.55e-29	105	142	0.325	0.373	PIN1_THEAN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Theileria annulata OX=5874 GN=PIN1 PE=1 SV=1
20	Q57YG1	1.06e-26	99.0	115	0.350	0.496	Q57YG1_TRYB2 Peptidyl-prolyl cis-trans isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.260 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01429 MBD	2.2e+02	13.0	Methyl-CpG binding domain
2	PF00639 Rotamase	7.6e-20	83.0	PPIC-type PPIASE domain
3	PF13145 Rotamase_2	3.5	19.9	PPIC-type PPIASE domain
4	PF13616 Rotamase_3	4.4e-18	77.3	PPIC-type PPIASE domain
5	PF00397 WW	2.8e-12	57.8	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247970

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479618	0.990	Myc proto-oncogene protein
2	9606.ENSP00000269305	0.984	Cellular tumor antigen p53
3	9606.ENSP00000471896	0.979	Interferon regulatory factor 3
4	9606.ENSP00000251849	0.971	RAF proto-oncogene serine/threonine-protein kinase
5	9606.ENSP00000378699	0.967	Cyclin-dependent kinase 1
6	9606.ENSP00000418447	0.962	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
7	9606.ENSP00000367545	0.955	Tumor protein p73
8	9606.ENSP00000324806	0.953	Glycogen synthase kinase-3 beta
9	9606.ENSP00000256442	0.948	G2/mitotic-specific cyclin-B1
10	9606.ENSP00000480158	0.945	DNA-directed RNA polymerase II subunit RPB1
11	9606.ENSP00000327465	0.941	Myelin transcription factor 1
12	9606.ENSP00000262320	0.936	Axin-1
13	9606.ENSP00000371267	0.928	14-3-3 protein theta
14	9606.ENSP00000305355	0.916	Protein kinase C beta type
15	9606.ENSP00000215832	0.915	Mitogen-activated protein kinase 1
16	9606.ENSP00000288602	0.912	Serine/threonine-protein kinase B-raf
17	9606.ENSP00000368699	0.911	Ubiquitin-like protein ISG15
18	9606.ENSP00000263025	0.910	Mitogen-activated protein kinase 3
19	9606.ENSP00000340989	0.910	14-3-3 protein sigma
20	9606.ENSP00000408695	0.907	Protein kinase C alpha type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.995	catalytic activity, acting on a protein
GO:0016859	0.966	cis-trans isomerase activity
GO:0003755	0.959	peptidyl-prolyl cis-trans isomerase activity
GO:0019899	0.861	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.993	positive regulation of cellular process
GO:0031399	0.990	regulation of protein modification process
GO:0035303	0.989	regulation of dephosphorylation
GO:0051247	0.985	positive regulation of protein metabolic process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0048583	0.980	regulation of response to stimulus
GO:0035304	0.979	regulation of protein dephosphorylation
GO:0035306	0.979	positive regulation of dephosphorylation
GO:0006807	0.978	nitrogen compound metabolic process
GO:0048523	0.978	negative regulation of cellular process
GO:0035307	0.972	positive regulation of protein dephosphorylation
GO:0043170	0.971	macromolecule metabolic process
GO:0051128	0.971	regulation of cellular component organization
GO:0042325	0.971	regulation of phosphorylation
GO:0001932	0.963	regulation of protein phosphorylation
GO:0042981	0.929	regulation of apoptotic process
GO:0009987	0.922	cellular process
GO:0001934	0.886	positive regulation of protein phosphorylation
GO:1901564	0.874	organonitrogen compound metabolic process
GO:0051248	0.860	negative regulation of protein metabolic process
GO:0051239	0.855	regulation of multicellular organismal process
GO:0019538	0.839	protein metabolic process
GO:0043412	0.829	macromolecule modification
GO:1903320	0.820	regulation of protein modification by small protein conjugation or removal
GO:0036211	0.808	protein modification process
GO:0043066	0.785	negative regulation of apoptotic process
GO:0010468	0.782	regulation of gene expression
GO:0050896	0.744	response to stimulus
GO:0018208	0.717	peptidyl-proline modification
GO:0030111	0.711	regulation of Wnt signaling pathway
GO:0051726	0.708	regulation of cell cycle
GO:0048584	0.696	positive regulation of response to stimulus
GO:1902991	0.690	regulation of amyloid precursor protein catabolic process
GO:0044237	0.684	cellular metabolic process
GO:1902531	0.668	regulation of intracellular signal transduction
GO:0065009	0.667	regulation of molecular function
GO:0019219	0.666	regulation of nucleobase-containing compound metabolic process
GO:1901214	0.616	regulation of neuron death
GO:0045595	0.616	regulation of cell differentiation
GO:0051240	0.603	positive regulation of multicellular organismal process
GO:0010942	0.589	positive regulation of cell death
GO:0043523	0.573	regulation of neuron apoptotic process
GO:1901215	0.571	negative regulation of neuron death
GO:0043065	0.558	positive regulation of apoptotic process
GO:1901216	0.552	positive regulation of neuron death
GO:0051155	0.541	positive regulation of striated muscle cell differentiation
GO:0009889	0.540	regulation of biosynthetic process
GO:0031326	0.525	regulation of cellular biosynthetic process
GO:0043524	0.513	negative regulation of neuron apoptotic process
GO:0055023	0.502	positive regulation of cardiac muscle tissue growth
GO:0010556	0.492	regulation of macromolecule biosynthetic process
GO:0010613	0.471	positive regulation of cardiac muscle hypertrophy
GO:0071840	0.464	cellular component organization or biogenesis
GO:0001558	0.463	regulation of cell growth
GO:0065008	0.452	regulation of biological quality
GO:0051252	0.444	regulation of RNA metabolic process
GO:0006355	0.434	regulation of DNA-templated transcription
GO:0031324	0.415	negative regulation of cellular metabolic process
GO:0030307	0.392	positive regulation of cell growth
GO:0006950	0.363	response to stress
GO:0016043	0.340	cellular component organization
GO:0051716	0.339	cellular response to stimulus
GO:0045935	0.325	positive regulation of nucleobase-containing compound metabolic process
GO:0023056	0.324	positive regulation of signaling
GO:0010647	0.324	positive regulation of cell communication
GO:0050790	0.318	regulation of catalytic activity
GO:0031647	0.314	regulation of protein stability

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.999	nucleus
GO:0005654	0.955	nucleoplasm
GO:0032991	0.751	protein-containing complex
GO:0005739	0.585	mitochondrion
GO:0120025	0.486	plasma membrane bounded cell projection
GO:0043232	0.405	intracellular non-membrane-bounded organelle
GO:0045202	0.369	synapse
GO:0098978	0.338	glutamatergic synapse
GO:0043005	0.335	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.2.-.-	0.966	Cis-trans-isomerases.
RHEA:16237	0.959	[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
EC:5.2.1.8	0.959	peptidylprolyl isomerase.

[back to server]