StarFunc result for job id Q13535

User Input

>input (2644 residues)
MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH
KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLS
QLDEHMGYLQSAPLQLMSMQNLEFIEVTLLMVLTRIIAIVFFRRQELLLWQIGCVLLEYG
SPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLVEMDTDQLKLYEEPLSKLIK
TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAG
YESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL
SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYS
GLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFY
TKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIY
SHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWAL
QSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSDIVKKEFASILGQLVCTLHG
MFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKIPSPVKL
AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG
FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVR
KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVTGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGH
QLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLIT
KVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDD
QHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSMVST
VDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVV
KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW
SVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCEL
EHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV
GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV
ELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHF
YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK
AYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVL
MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTD
KLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANH
ASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET
GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW
TPYM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5yz0A	0.431	0.478	0.000	2362	0.865	0.968	5yz0A.pdb.gz
2	AFDB:F1QMM7	0.932	0.935	0.000	2635	0.650	0.652	F1QMM7.pdb.gz
3	AFDB:Q13535	1.000	1.000	0.000	2644	1.000	1.000	Q13535.pdb.gz	ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens OX=9606 GN=ATR PE=1 SV=3
4	AFDB:Q9DE14	0.968	0.964	0.000	2654	0.728	0.725	Q9DE14.pdb.gz	ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis OX=8355 GN=atr PE=1 SV=2
5	AFDB:Q9VXG8	0.707	0.738	7.583E-92	2517	0.227	0.238	Q9VXG8.pdb.gz	ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster OX=7227 GN=mei-41 PE=1 SV=2
6	AFDB:Q02099	0.597	0.656	3.386E-87	2386	0.230	0.255	Q02099.pdb.gz	RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad3 PE=1 SV=2
7	AFDB:P38111	0.564	0.624	9.103E-65	2368	0.181	0.202	P38111.pdb.gz	ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEC1 PE=1 SV=1
8	PDB:6z2wE	0.554	0.622	1.479E-56	2325	0.167	0.190	6z2wE.pdb.gz	Mechanism of auto-inhibition and activation of Mec1 ATR checkpoint kinase.
9	PDB:7sicA	0.537	0.515	4.140E-56	2773	0.181	0.172	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
10	PDB:7ni5A	0.499	0.476	6.228E-55	2791	0.187	0.177	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
11	AFDB:Q86C65	0.348	0.386	1.178E-49	2380	0.167	0.185	Q86C65.pdb.gz	TOR_DICDI Serine/threonine-protein kinase tor OS=Dictyostelium discoideum OX=44689 GN=tor PE=1 SV=1
12	AFDB:Q22258	0.509	0.529	2.506E-49	2531	0.164	0.171	Q22258.pdb.gz	ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans OX=6239 GN=atl-1 PE=2 SV=2
13	AFDB:Q9VK45	0.354	0.378	5.134E-48	2470	0.161	0.172	Q9VK45.pdb.gz	TOR_DROME Serine/threonine-protein kinase mTor OS=Drosophila melanogaster OX=7227 GN=mTor PE=1 SV=1
14	AFDB:O14356	0.355	0.399	1.892E-47	2335	0.165	0.186	O14356.pdb.gz	TOR1_SCHPO Serine/threonine-protein kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tor1 PE=1 SV=1
15	PDB:6zwmB	0.338	0.403	2.633E-44	2185	0.163	0.198	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
16	PDB:6bcuA	0.349	0.416	5.054E-44	2204	0.159	0.191	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
17	PDB:7owgB	0.318	0.383	7.709E-37	2152	0.166	0.204	7owgB.pdb.gz
18	PDB:5x6oC	0.479	0.616	8.257E-37	1997	0.152	0.202	5x6oC.pdb.gz
19	PDB:7otmA	0.309	0.232	3.962E-33	3656	0.161	0.116	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
20	PDB:7tyrA	0.325	0.229	7.348E-33	3905	0.156	0.106	7tyrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G5M3	0.0	4788	2570	0.884	0.909	A0A8I6G5M3_RAT Serine/threonine-protein kinase ATR OS=Rattus norvegicus OX=10116 GN=Atr PE=3 SV=1
2	C8VB89	0.0	723	2454	0.187	0.201	C8VB89_EMENI Serine/threonine-protein kinase ATR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06975 PE=3 SV=1
3	D3Z822	0.0	4919	2636	0.908	0.910	D3Z822_RAT Serine/threonine-protein kinase ATR OS=Rattus norvegicus OX=10116 GN=Atr PE=3 SV=3
4	G0S1R8	0.0	661	2963	0.176	0.157	G0S1R8_CHATD non-specific serine/threonine protein kinase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0014570 PE=1 SV=1
5	Q02099	0.0	711	2386	0.203	0.225	RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad3 PE=1 SV=2
6	Q13535	0.0	5501	2644	1.000	1.000	ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens OX=9606 GN=ATR PE=1 SV=3
7	Q9DE14	0.0	3936	2654	0.731	0.728	ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis OX=8355 GN=atr PE=1 SV=2
8	Q9FKS4	0.0	791	2702	0.204	0.200	ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana OX=3702 GN=ATR PE=2 SV=2
9	Q9JKK8	0.0	4896	2635	0.904	0.907	ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus OX=10090 GN=Atr PE=1 SV=2
10	Q9VXG8	0.0	781	2517	0.199	0.209	ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster OX=7227 GN=mei-41 PE=1 SV=2
11	Q381W7	7.98e-117	419	2860	0.134	0.124	Q381W7_TRYB2 Phosphatidylinositol 3-related kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6300 PE=4 SV=1
12	P38111	2.37e-114	410	2368	0.152	0.170	ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEC1 PE=1 SV=1
13	F1QJB6	4.27e-75	282	3091	0.104	0.089	F1QJB6_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=atm PE=1 SV=2
14	Q9M3G7	3.12e-68	260	3856	0.106	0.073	ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana OX=3702 GN=ATM PE=1 SV=1
15	Q22258	1.58e-66	254	2531	0.104	0.109	ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans OX=6239 GN=atl-1 PE=2 SV=2
16	E5QCG9	2.87e-66	249	1057	0.106	0.265	E5QCG9_CAEEL non-specific serine/threonine protein kinase OS=Caenorhabditis elegans OX=6239 GN=atl-1 PE=1 SV=1
17	Q9PVT8	4.00e-62	219	357	0.048	0.353	Q9PVT8_CHICK non-specific serine/threonine protein kinase (Fragment) OS=Gallus gallus OX=9031 GN=ATM PE=2 SV=1
18	Q13315	1.65e-61	238	3056	0.065	0.056	ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens OX=9606 GN=ATM PE=1 SV=4
19	Q62388	5.51e-61	236	3066	0.063	0.054	ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus OX=10090 GN=Atm PE=1 SV=2
20	P38110	1.55e-60	234	2787	0.061	0.058	ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TEL1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11865 DUF3385	1.2e+02	14.0	Domain of unknown function (DUF3385)
2	PF02259 FAT	1.7e-47	174.0	FAT domain
3	PF02260 FATC	1.3e-10	52.1	FATC domain
4	PF02985 HEAT	0.02	26.1	HEAT repeat
5	PF13646 HEAT_2	11	17.8	HEAT repeats
6	PF13513 HEAT_EZ	1.7e+02	14.2	HEAT-like repeat
7	PF08311 Mad3_BUB1_I	4.6	18.6	Mad3/BUB1 homology region 1
8	PF00454 PI3_PI4_kinase	5.8e-55	198.4	Phosphatidylinositol 3- and 4-kinase
9	PF09432 THP2	2.7e+02	13.0	Tho complex subunit THP2
10	PF00515 TPR_1	2.3e+02	13.0	Tetratricopeptide repeat
11	PF13428 TPR_14	6.1	18.9	Tetratricopeptide repeat
12	PF07719 TPR_2	5e+02	12.3	Tetratricopeptide repeat
13	PF17798 TRIF-NTD	3.3e+02	12.9	TRIF N-terminal domain
14	PF08064 UME	2.5e-15	67.6	UME (NUC010) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343741

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260810	0.999	DNA topoisomerase 2-binding protein 1
2	9606.ENSP00000323099	0.999	ATR-interacting protein
3	9606.ENSP00000372023	0.999	Serine/threonine-protein kinase Chk2
4	9606.ENSP00000388648	0.999	Serine/threonine-protein kinase Chk1
5	9606.ENSP00000426191	0.999	Cell cycle checkpoint protein RAD17
6	9606.ENSP00000278616	0.998	Serine-protein kinase ATM
7	9606.ENSP00000363017	0.998	Replication protein A 32 kDa subunit
8	9606.ENSP00000254719	0.997	Replication protein A 70 kDa DNA-binding subunit
9	9606.ENSP00000418960	0.996	Breast cancer type 1 susceptibility protein
10	9606.ENSP00000269305	0.995	Cellular tumor antigen p53
11	9606.ENSP00000347232	0.995	Bloom syndrome protein
12	9606.ENSP00000258774	0.993	Checkpoint protein HUS1
13	9606.ENSP00000265433	0.993	Nibrin
14	9606.ENSP00000311360	0.993	Cell cycle checkpoint control protein RAD9A
15	9606.ENSP00000267430	0.991	Fanconi anemia group M protein
16	9606.ENSP00000298139	0.989	Werner syndrome ATP-dependent helicase
17	9606.ENSP00000371469	0.989	Cell cycle checkpoint protein RAD1
18	9606.ENSP00000287647	0.988	Fanconi anemia group D2 protein
19	9606.ENSP00000351284	0.988	DNA repair protein RAD52 homolog
20	9606.ENSP00000450607	0.987	Protein timeless homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0044877	0.995	protein-containing complex binding
GO:0032407	0.438	MutSalpha complex binding
GO:0032405	0.431	MutLalpha complex binding
GO:0003676	0.363	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0006974	0.987	cellular response to DNA damage stimulus
GO:0050789	0.977	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0035556	0.920	intracellular signal transduction
GO:1901987	0.905	regulation of cell cycle phase transition
GO:0044260	0.901	cellular macromolecule metabolic process
GO:0034641	0.877	cellular nitrogen compound metabolic process
GO:0045786	0.862	negative regulation of cell cycle
GO:0010948	0.847	negative regulation of cell cycle process
GO:1901360	0.837	organic cyclic compound metabolic process
GO:0046483	0.834	heterocycle metabolic process
GO:0006725	0.832	cellular aromatic compound metabolic process
GO:0019222	0.814	regulation of metabolic process
GO:0042770	0.811	signal transduction in response to DNA damage
GO:0031570	0.809	DNA integrity checkpoint signaling
GO:0000077	0.787	DNA damage checkpoint signaling
GO:0060255	0.786	regulation of macromolecule metabolic process
GO:0019538	0.785	protein metabolic process
GO:0080090	0.736	regulation of primary metabolic process
GO:0051171	0.733	regulation of nitrogen compound metabolic process
GO:0031323	0.707	regulation of cellular metabolic process
GO:0090304	0.690	nucleic acid metabolic process
GO:0043412	0.660	macromolecule modification
GO:0051052	0.643	regulation of DNA metabolic process
GO:0036211	0.629	protein modification process
GO:0006259	0.629	DNA metabolic process
GO:0048518	0.591	positive regulation of biological process
GO:0006281	0.528	DNA repair
GO:0048522	0.477	positive regulation of cellular process
GO:0009893	0.455	positive regulation of metabolic process
GO:0071840	0.454	cellular component organization or biogenesis
GO:0010604	0.449	positive regulation of macromolecule metabolic process
GO:0051173	0.446	positive regulation of nitrogen compound metabolic process
GO:0016043	0.436	cellular component organization
GO:0031325	0.388	positive regulation of cellular metabolic process
GO:0048583	0.325	regulation of response to stimulus
GO:0006996	0.316	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:0005737	0.977	cytoplasm
GO:0012505	0.976	endomembrane system
GO:0098687	0.892	chromosomal region
GO:0000781	0.759	chromosome, telomeric region
GO:0016604	0.729	nuclear body
GO:0070310	0.705	ATR-ATRIP complex
GO:0005794	0.558	Golgi apparatus
GO:0005829	0.509	cytosol
GO:0016605	0.499	PML body
GO:0000785	0.391	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]