StarFunc result for job id Q13541

User Input

>input (118 residues)
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13541	0.999	0.999	1.122E-20	118	1.000	1.000	Q13541.pdb.gz	4EBP1_HUMAN Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3
2	AFDB:P70445	0.337	0.332	6.731E-11	120	0.576	0.567	P70445.pdb.gz	4EBP2_MOUSE Eukaryotic translation initiation factor 4E-binding protein 2 OS=Mus musculus OX=10090 GN=Eif4ebp2 PE=1 SV=1
3	AFDB:Q98TT6	0.352	0.369	2.052E-9	112	0.508	0.536	Q98TT6.pdb.gz	4EB3L_DANRE Eukaryotic translation initiation factor 4E-binding protein 3-like OS=Danio rerio OX=7955 GN=eif4ebp3l PE=1 SV=1
4	AFDB:Q9XZ56	0.339	0.342	6.983E-7	117	0.288	0.291	Q9XZ56.pdb.gz	4EBP_DROME Eukaryotic translation initiation factor 4E-binding protein OS=Drosophila melanogaster OX=7227 GN=Thor PE=1 SV=1
5	PDB:1j8iA	0.211	0.253	2.240E-1	93	0.161	0.204	1j8iA.pdb.gz
6	PDB:4ixmA	0.249	0.106	9.150E-1	318	0.051	0.019	4ixmA.pdb.gz	Metal binding properties of Escherichia coli YjiA, a member of the metal homeostasis-associated COG0523 family of GTPases.
7	AFDB:Q9GZV5	0.143	0.054	1.261	400	0.186	0.055	Q9GZV5.pdb.gz	WWTR1_HUMAN WW domain-containing transcription regulator protein 1 OS=Homo sapiens OX=9606 GN=WWTR1 PE=1 SV=1
8	PDB:1u8cB	0.146	0.047	1.368	599	0.051	0.010	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
9	AFDB:Q03430	0.189	0.083	1.442	361	0.136	0.044	Q03430.pdb.gz	RSM28_YEAST Small ribosomal subunit protein mS46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSM28 PE=1 SV=2
10	PDB:1f9rA	0.148	0.230	1.672	65	0.068	0.123	1f9rA.pdb.gz
11	AFDB:O57337	0.169	0.076	2.016	290	0.169	0.069	O57337.pdb.gz	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
12	PDB:2ra4B	0.198	0.322	2.186	65	0.076	0.138	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
13	AFDB:Q9W2F0	0.173	0.037	2.305	835	0.186	0.026	Q9W2F0.pdb.gz	Q9W2F0_DROME LD45439p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10321 PE=2 SV=1
14	AFDB:Q90Z12	0.181	0.084	2.636	281	0.144	0.060	Q90Z12.pdb.gz	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
15	PDB:2mgsA	0.169	0.246	2.673	71	0.034	0.056	2mgsA.pdb.gz
16	PDB:6m5rA	0.137	0.031	2.673	646	0.051	0.009	6m5rA.pdb.gz	Architecture of the herpesvirus genome-packaging complex and implications for DNA translocation.
17	PDB:3jyyB	0.174	0.080	3.057	266	0.025	0.011	3jyyB.pdb.gz	Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
18	PDB:2q8tB	0.201	0.322	3.495	65	0.051	0.092	2q8tB.pdb.gz
19	PDB:5lzbz	0.098	0.026	3.495	614	0.059	0.011	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
20	AFDB:Q6NN85	0.185	0.024	4.213	1045	0.169	0.019	Q6NN85.pdb.gz	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13541	4.55e-82	237	118	1.000	1.000	4EBP1_HUMAN Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3
2	Q62622	6.73e-75	219	117	0.924	0.932	4EBP1_RAT Eukaryotic translation initiation factor 4E-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Eif4ebp1 PE=1 SV=3
3	Q60876	1.24e-72	213	117	0.907	0.915	4EBP1_MOUSE Eukaryotic translation initiation factor 4E-binding protein 1 OS=Mus musculus OX=10090 GN=Eif4ebp1 PE=1 SV=3
4	P70445	7.40e-36	120	120	0.585	0.575	4EBP2_MOUSE Eukaryotic translation initiation factor 4E-binding protein 2 OS=Mus musculus OX=10090 GN=Eif4ebp2 PE=1 SV=1
5	Q13542	2.93e-35	119	120	0.576	0.567	4EBP2_HUMAN Eukaryotic translation initiation factor 4E-binding protein 2 OS=Homo sapiens OX=9606 GN=EIF4EBP2 PE=1 SV=1
6	Q497A9	3.17e-35	119	120	0.593	0.583	Q497A9_RAT Eukaryotic translation initiation factor 4E binding protein 2 OS=Rattus norvegicus OX=10116 GN=Eif4ebp2 PE=1 SV=1
7	Q98TT6	1.02e-29	105	112	0.542	0.571	4EB3L_DANRE Eukaryotic translation initiation factor 4E-binding protein 3-like OS=Danio rerio OX=7955 GN=eif4ebp3l PE=1 SV=1
8	A0A8I6A0I3	4.76e-29	103	122	0.492	0.475	A0A8I6A0I3_RAT Eukaryotic translation initiation factor 4E binding protein 2 OS=Rattus norvegicus OX=10116 GN=Eif4ebp2 PE=1 SV=1
9	O60516	2.39e-25	93.6	100	0.424	0.500	4EBP3_HUMAN Eukaryotic translation initiation factor 4E-binding protein 3 OS=Homo sapiens OX=9606 GN=EIF4EBP3 PE=1 SV=1
10	Q9XZ56	6.42e-19	77.8	117	0.322	0.325	4EBP_DROME Eukaryotic translation initiation factor 4E-binding protein OS=Drosophila melanogaster OX=7227 GN=Thor PE=1 SV=1
11	Q5VU43	0.54	31.6	2346	0.203	0.010	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
12	B3DKF4	0.69	30.8	141	0.127	0.106	B3DKF4_DANRE Granulito OS=Danio rerio OX=7955 GN=LOC561889 PE=2 SV=1
13	Q5VST9	0.73	31.2	7968	0.246	0.004	OBSCN_HUMAN Obscurin OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=3
14	O97267	1.8	30.0	2114	0.178	0.010	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
15	O75369	2.0	30.0	2602	0.144	0.007	FLNB_HUMAN Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2
16	E7EN95	2.2	30.0	2409	0.144	0.007	E7EN95_HUMAN Filamin B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=1
17	Q80X90	2.8	29.6	2602	0.144	0.007	FLNB_MOUSE Filamin-B OS=Mus musculus OX=10090 GN=Flnb PE=1 SV=3
18	A6NGQ3	3.7	29.3	8923	0.127	0.002	A6NGQ3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=5
19	Q8NFT6	3.8	29.3	615	0.212	0.041	DBF4B_HUMAN Protein DBF4 homolog B OS=Homo sapiens OX=9606 GN=DBF4B PE=1 SV=1
20	J3KNK7	4.0	28.9	370	0.119	0.038	J3KNK7_HUMAN Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05456 eIF_4EBP	2.7e-40	148.3	Eukaryotic translation initiation factor 4E binding protein (EIF4EBP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307272	0.999	Regulatory-associated protein of mTOR
2	9606.ENSP00000354558	0.999	Serine/threonine-protein kinase mTOR
3	9606.ENSP00000425561	0.999	Eukaryotic translation initiation factor 4E
4	9606.ENSP00000456405	0.997	Target of rapamycin complex subunit LST8
5	9606.ENSP00000262187	0.996	GTP-binding protein Rheb
6	9606.ENSP00000451828	0.994	RAC-alpha serine/threonine-protein kinase
7	9606.ENSP00000416255	0.993	Eukaryotic translation initiation factor 4 gamma 1
8	9606.ENSP00000258416	0.991	Eukaryotic translation initiation factor 4E type 2
9	9606.ENSP00000375711	0.981	Proline-rich AKT1 substrate 1
10	9606.ENSP00000383003	0.974	Peptidyl-prolyl cis-trans isomerase FKBP1A
11	9606.ENSP00000479667	0.964	Ribosomal protein S6 kinase alpha-5
12	9606.ENSP00000369899	0.954	Ras-related GTP-binding protein A
13	9606.ENSP00000418447	0.954	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
14	9606.ENSP00000262850	0.953	Ras-related GTP-binding protein B
15	9606.ENSP00000362092	0.952	Ras-related GTP-binding protein C
16	9606.ENSP00000358423	0.942	Ras-related GTP-binding protein D
17	9606.ENSP00000263025	0.938	Mitogen-activated protein kinase 3
18	9606.ENSP00000215832	0.937	Mitogen-activated protein kinase 1
19	9606.ENSP00000333896	0.937	Ribosomal protein S6 kinase alpha-4
20	9606.ENSP00000225577	0.935	Ribosomal protein S6 kinase beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030371	1.000	translation repressor activity
GO:0008190	1.000	eukaryotic initiation factor 4E binding
GO:0019899	0.412	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0080090	0.996	regulation of primary metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0050896	0.993	response to stimulus
GO:0006417	0.986	regulation of translation
GO:0051716	0.980	cellular response to stimulus
GO:0048519	0.980	negative regulation of biological process
GO:0007154	0.975	cell communication
GO:0048523	0.966	negative regulation of cellular process
GO:0023052	0.963	signaling
GO:0006446	0.963	regulation of translational initiation
GO:0051248	0.958	negative regulation of protein metabolic process
GO:0017148	0.948	negative regulation of translation
GO:0007165	0.910	signal transduction
GO:0048518	0.887	positive regulation of biological process
GO:0048522	0.875	positive regulation of cellular process
GO:0008152	0.805	metabolic process
GO:0035556	0.764	intracellular signal transduction
GO:0071704	0.716	organic substance metabolic process
GO:0044237	0.668	cellular metabolic process
GO:0044238	0.657	primary metabolic process
GO:0006807	0.561	nitrogen compound metabolic process
GO:0042221	0.553	response to chemical
GO:0070887	0.543	cellular response to chemical stimulus
GO:0010033	0.533	response to organic substance
GO:0045947	0.453	negative regulation of translational initiation
GO:0043170	0.441	macromolecule metabolic process
GO:1901564	0.398	organonitrogen compound metabolic process
GO:0009893	0.393	positive regulation of metabolic process
GO:0019538	0.378	protein metabolic process
GO:1901700	0.372	response to oxygen-containing compound
GO:0010604	0.366	positive regulation of macromolecule metabolic process
GO:0010646	0.363	regulation of cell communication
GO:0023051	0.361	regulation of signaling
GO:0006950	0.331	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.887	protein-containing complex
GO:0005634	0.853	nucleus
GO:0016020	0.616	membrane
GO:0030054	0.524	cell junction
GO:0070013	0.466	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]