StarFunc result for job id Q13542

User Input

>input (120 residues)
MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLL
DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70445	0.729	0.729	4.447E-20	120	0.950	0.950	P70445.pdb.gz	4EBP2_MOUSE Eukaryotic translation initiation factor 4E-binding protein 2 OS=Mus musculus OX=10090 GN=Eif4ebp2 PE=1 SV=1
2	AFDB:Q98TT6	0.608	0.650	6.220E-12	112	0.450	0.482	Q98TT6.pdb.gz	4EB3L_DANRE Eukaryotic translation initiation factor 4E-binding protein 3-like OS=Danio rerio OX=7955 GN=eif4ebp3l PE=1 SV=1
3	AFDB:Q13541	0.332	0.336	3.572E-11	118	0.575	0.585	Q13541.pdb.gz	4EBP1_HUMAN Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3
4	AFDB:Q9XZ56	0.484	0.494	1.854E-8	117	0.300	0.308	Q9XZ56.pdb.gz	4EBP_DROME Eukaryotic translation initiation factor 4E-binding protein OS=Drosophila melanogaster OX=7227 GN=Thor PE=1 SV=1
5	PDB:1j8iA	0.224	0.271	1.675E-1	93	0.142	0.183	1j8iA.pdb.gz
6	PDB:4ixmA	0.221	0.100	2.049E-1	318	0.058	0.022	4ixmA.pdb.gz	Metal binding properties of Escherichia coli YjiA, a member of the metal homeostasis-associated COG0523 family of GTPases.
7	PDB:1xy7B	0.220	0.217	4.293E-1	122	0.067	0.066	1xy7B.pdb.gz
8	PDB:2jr7A	0.185	0.249	5.252E-1	84	0.125	0.179	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein
9	PDB:1u8cB	0.154	0.046	6.426E-1	599	0.042	0.008	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
10	AFDB:Q9H5Z6	0.244	0.073	9.460E-1	455	0.108	0.029	Q9H5Z6.pdb.gz	F124B_HUMAN Protein FAM124B OS=Homo sapiens OX=9606 GN=FAM124B PE=1 SV=3
11	PDB:2ra4B	0.185	0.312	1.177	65	0.075	0.138	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
12	AFDB:Q90Z12	0.169	0.076	1.416	281	0.175	0.075	Q90Z12.pdb.gz	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
13	PDB:7wt0A	0.242	0.169	1.440	185	0.092	0.059	7wt0A.pdb.gz	Crystal structures of human glyoxalase I and its complex with TLSC702 reveal inhibitor binding mode and substrate preference.
14	PDB:2o5cA	0.164	0.043	1.540	634	0.058	0.011	2o5cA.pdb.gz	Structural Studies of E. coli Topoisomerase III-DNA Complexes Reveal a Novel Type IA Topoisomerase-DNA Conformational Intermediate.
15	PDB:5lzbz	0.164	0.049	1.540	614	0.092	0.018	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
16	PDB:1f9rA	0.147	0.243	1.647	65	0.075	0.138	1f9rA.pdb.gz
17	AFDB:Q6NN85	0.175	0.024	1.982	1045	0.192	0.022	Q6NN85.pdb.gz	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2
18	AFDB:Q9W2F0	0.141	0.033	2.120	835	0.158	0.023	Q9W2F0.pdb.gz	Q9W2F0_DROME LD45439p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10321 PE=2 SV=1
19	AFDB:Q03430	0.149	0.059	2.593	361	0.125	0.042	Q03430.pdb.gz	RSM28_YEAST Small ribosomal subunit protein mS46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSM28 PE=1 SV=2
20	AFDB:O00268	0.145	0.025	2.774	1085	0.167	0.018	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13542	9.73e-87	249	120	1.000	1.000	4EBP2_HUMAN Eukaryotic translation initiation factor 4E-binding protein 2 OS=Homo sapiens OX=9606 GN=EIF4EBP2 PE=1 SV=1
2	Q497A9	8.22e-76	221	120	0.950	0.950	Q497A9_RAT Eukaryotic translation initiation factor 4E binding protein 2 OS=Rattus norvegicus OX=10116 GN=Eif4ebp2 PE=1 SV=1
3	P70445	2.18e-75	221	120	0.950	0.950	4EBP2_MOUSE Eukaryotic translation initiation factor 4E-binding protein 2 OS=Mus musculus OX=10090 GN=Eif4ebp2 PE=1 SV=1
4	A0A8I6A0I3	1.26e-68	203	122	0.883	0.869	A0A8I6A0I3_RAT Eukaryotic translation initiation factor 4E binding protein 2 OS=Rattus norvegicus OX=10116 GN=Eif4ebp2 PE=1 SV=1
5	Q60876	1.96e-39	129	117	0.575	0.590	4EBP1_MOUSE Eukaryotic translation initiation factor 4E-binding protein 1 OS=Mus musculus OX=10090 GN=Eif4ebp1 PE=1 SV=3
6	Q62622	4.03e-39	129	117	0.575	0.590	4EBP1_RAT Eukaryotic translation initiation factor 4E-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Eif4ebp1 PE=1 SV=3
7	Q13541	5.89e-37	123	118	0.567	0.576	4EBP1_HUMAN Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3
8	Q98TT6	1.06e-34	117	112	0.533	0.571	4EB3L_DANRE Eukaryotic translation initiation factor 4E-binding protein 3-like OS=Danio rerio OX=7955 GN=eif4ebp3l PE=1 SV=1
9	O60516	7.11e-31	107	100	0.458	0.550	4EBP3_HUMAN Eukaryotic translation initiation factor 4E-binding protein 3 OS=Homo sapiens OX=9606 GN=EIF4EBP3 PE=1 SV=1
10	Q9XZ56	7.66e-23	87.8	117	0.392	0.402	4EBP_DROME Eukaryotic translation initiation factor 4E-binding protein OS=Drosophila melanogaster OX=7227 GN=Thor PE=1 SV=1
11	B3DKF4	0.15	32.7	141	0.133	0.113	B3DKF4_DANRE Granulito OS=Danio rerio OX=7955 GN=LOC561889 PE=2 SV=1
12	P00561	0.65	31.6	820	0.175	0.026	AK1H_ECOLI Bifunctional aspartokinase/homoserine dehydrogenase 1 OS=Escherichia coli (strain K12) OX=83333 GN=thrA PE=1 SV=2
13	A0A2X0TW08	5.7	28.9	790	0.208	0.032	A0A2X0TW08_HUMAN PLEKHG6 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=4 SV=1
14	Q3KR16	5.7	28.9	790	0.208	0.032	PKHG6_HUMAN Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05456 eIF_4EBP	3.1e-43	157.8	Eukaryotic translation initiation factor 4E binding protein (EIF4EBP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010361146.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010363832.1	0.988	Eukaryotic translation initiation factor 4E
2	61622.XP_010352564.1	0.981	Regulatory-associated protein of mTOR isoform X1
3	61622.XP_010351824.1	0.969	Mechanistic target of rapamycin
4	61622.XP_010384696.1	0.947	Belongs to the eukaryotic initiation factor 4E family.
5	61622.XP_010386175.1	0.845	MTOR associated protein, LST8 homolog
6	61622.XP_010382347.1	0.814	Ras homolog enriched in brain
7	61622.XP_010364413.1	0.813	Leucine-rich repeat serine/threonine-protein kinase 2 isoform X1
8	61622.XP_010379987.1	0.813	Leucine-rich repeat serine/threonine-protein kinase 1
9	61622.XP_010383599.1	0.807	Eukaryotic translation initiation factor 4E-binding protein 1
10	61622.XP_010352855.1	0.803	Belongs to the eukaryotic initiation factor 4E family.
11	61622.XP_010385875.1	0.713	Unkempt family zinc finger
12	61622.XP_010364478.1	0.712	Eukaryotic translation initiation factor 4 gamma 1
13	61622.XP_010356789.1	0.708	FK506 binding protein 1B
14	61622.XP_010359608.1	0.708	FK506 binding protein 1A
15	61622.XP_010384286.1	0.697	Eukaryotic translation initiation factor 4E type 3
16	61622.XP_010354739.1	0.681	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 ESTs, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
17	61622.XP_010364022.1	0.681	Ras related GTP binding A
18	61622.XP_010378772.1	0.681	Ras-related GTP-binding protein B-like isoform X1
19	61622.XP_010362635.1	0.676	Eukaryotic translation initiation factor 4 gamma 3 isoform X1
20	61622.XP_010362630.1	0.674	PTEN induced putative kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008190	0.999	eukaryotic initiation factor 4E binding
GO:0045182	0.985	translation regulator activity
GO:0030371	0.930	translation repressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0071704	0.959	organic substance metabolic process
GO:0044238	0.951	primary metabolic process
GO:0044237	0.948	cellular metabolic process
GO:0050794	0.935	regulation of cellular process
GO:0019222	0.898	regulation of metabolic process
GO:0006807	0.870	nitrogen compound metabolic process
GO:0031323	0.870	regulation of cellular metabolic process
GO:0060255	0.867	regulation of macromolecule metabolic process
GO:0010468	0.829	regulation of gene expression
GO:0031326	0.824	regulation of cellular biosynthetic process
GO:0051246	0.815	regulation of protein metabolic process
GO:0010556	0.812	regulation of macromolecule biosynthetic process
GO:0048523	0.808	negative regulation of cellular process
GO:0043170	0.778	macromolecule metabolic process
GO:0050896	0.776	response to stimulus
GO:1901564	0.775	organonitrogen compound metabolic process
GO:0051716	0.759	cellular response to stimulus
GO:0019538	0.758	protein metabolic process
GO:0043604	0.753	amide biosynthetic process
GO:2000112	0.739	regulation of cellular macromolecule biosynthetic process
GO:0010467	0.738	gene expression
GO:0006518	0.730	peptide metabolic process
GO:0009892	0.711	negative regulation of metabolic process
GO:0043043	0.707	peptide biosynthetic process
GO:0007154	0.690	cell communication
GO:0023052	0.670	signaling
GO:0007165	0.658	signal transduction
GO:0044260	0.615	cellular macromolecule metabolic process
GO:0006412	0.594	translation
GO:0010608	0.552	post-transcriptional regulation of gene expression
GO:0006417	0.535	regulation of translation
GO:0031324	0.532	negative regulation of cellular metabolic process
GO:0010605	0.495	negative regulation of macromolecule metabolic process
GO:0051172	0.465	negative regulation of nitrogen compound metabolic process
GO:0048518	0.304	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005737	0.987	cytoplasm
GO:0005829	0.974	cytosol
GO:0016020	0.842	membrane
GO:0030054	0.759	cell junction
GO:0043226	0.648	organelle
GO:0045202	0.509	synapse
GO:0043229	0.363	intracellular organelle
GO:0005634	0.348	nucleus
GO:0032991	0.343	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]