StarFunc result for job id Q13546

User Input

>input (671 residues)
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13546	1.000	1.000	0.000	671	1.000	1.000	Q13546.pdb.gz	RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1 PE=1 SV=3
2	AFDB:D3ZYL0	0.479	0.489	6.856E-78	658	0.703	0.717	D3ZYL0.pdb.gz	D3ZYL0_RAT Receptor interacting serine/threonine kinase 1 OS=Rattus norvegicus OX=10116 GN=Ripk1 PE=1 SV=1
3	AFDB:Q60855	0.477	0.488	3.940E-77	656	0.697	0.713	Q60855.pdb.gz	RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Ripk1 PE=1 SV=1
4	AFDB:B3DK89	0.454	0.452	1.409E-47	675	0.383	0.381	B3DK89.pdb.gz
5	AFDB:Q9VE06	0.317	0.180	2.126E-17	1213	0.159	0.088	Q9VE06.pdb.gz	Q9VE06_DROME Center divider, isoform A OS=Drosophila melanogaster OX=7227 GN=cdi PE=2 SV=1
6	AFDB:A0A024R8E2	0.354	0.215	3.377E-17	1130	0.167	0.099	A0A024R8E2.pdb.gz
7	PDB:4fl2A	0.371	0.444	1.283E-16	555	0.116	0.141	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
8	AFDB:P38990	0.329	0.203	2.265E-16	1142	0.195	0.115	P38990.pdb.gz	SAK1_YEAST SNF1-activating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAK1 PE=1 SV=1
9	PDB:2h8hA	0.353	0.523	3.588E-16	445	0.119	0.180	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
10	PDB:1k9aB	0.340	0.510	5.415E-16	441	0.121	0.184	1k9aB.pdb.gz
11	AFDB:Q59LK7	0.354	0.272	7.783E-16	891	0.131	0.099	Q59LK7.pdb.gz	Q59LK7_CANAL Serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KIC1 PE=4 SV=1
12	PDB:4k2rA	0.349	0.422	1.113E-15	551	0.118	0.143	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	AFDB:H2L099	0.348	0.357	2.292E-15	653	0.161	0.165	H2L099.pdb.gz	GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans OX=6239 GN=gck-1 PE=1 SV=1
14	AFDB:Q8IGS1	0.343	0.358	2.541E-15	642	0.171	0.179	Q8IGS1.pdb.gz	Q8IGS1_DROME RE38276p OS=Drosophila melanogaster OX=7227 GN=GckIII PE=2 SV=1
15	PDB:6lk5A	0.337	0.800	3.449E-15	265	0.091	0.230	6lk5A.pdb.gz
16	PDB:6s73A	0.333	0.783	5.480E-15	269	0.092	0.230	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:4zhxA	0.341	0.542	7.087E-15	409	0.116	0.191	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:5u6yA	0.337	0.481	1.456E-14	459	0.107	0.157	5u6yA.pdb.gz
19	PDB:7myjC	0.333	0.471	1.456E-14	465	0.131	0.189	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
20	PDB:7mfdA	0.357	0.568	2.087E-14	410	0.109	0.178	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZYL0	0.0	965	658	0.703	0.717	D3ZYL0_RAT Receptor interacting serine/threonine kinase 1 OS=Rattus norvegicus OX=10116 GN=Ripk1 PE=1 SV=1
2	Q13546	0.0	1406	671	1.000	1.000	RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1 PE=1 SV=3
3	Q60855	0.0	955	656	0.699	0.715	RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Ripk1 PE=1 SV=1
4	Q0MSH9	1.15e-145	441	661	0.401	0.407	Q0MSH9_DANRE Receptor-interacting protein 1 OS=Danio rerio OX=7955 GN=rip1 PE=2 SV=1
5	Q9Y572	4.37e-37	147	518	0.142	0.183	RIPK3_HUMAN Receptor-interacting serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=RIPK3 PE=1 SV=2
6	Q9ERK0	3.05e-35	144	786	0.186	0.159	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
7	P57078	6.08e-34	140	832	0.137	0.111	RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1
8	Q9H4D1	1.67e-33	139	784	0.137	0.117	Q9H4D1_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=dik PE=2 SV=1
9	P58801	2.52e-33	137	539	0.130	0.161	RIPK2_MOUSE Receptor-interacting serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Ripk2 PE=1 SV=1
10	A0A060WPC3	3.19e-33	137	589	0.176	0.200	A0A060WPC3_ONCMY Receptor-interacting serine/threonine-protein kinase 2 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00058388001 PE=4 SV=1
11	Q8BZ25	1.60e-32	136	745	0.137	0.123	ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1
12	Q9QZL0	5.18e-32	132	486	0.151	0.208	RIPK3_MOUSE Receptor-interacting serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Ripk3 PE=1 SV=2
13	A0A0S2Z4Z8	1.06e-31	132	540	0.130	0.161	A0A0S2Z4Z8_HUMAN Receptor-interacting serine-threonine kinase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RIPK2 PE=2 SV=1
14	O43353	1.06e-31	132	540	0.130	0.161	RIPK2_HUMAN Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2 PE=1 SV=2
15	Q4V958	1.74e-31	132	584	0.139	0.159	Q4V958_DANRE Receptor-interacting serine/threonine-protein kinase 2 OS=Danio rerio OX=7955 GN=RICK PE=2 SV=1
16	Q8NFD2	4.47e-31	132	765	0.131	0.115	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
17	Q66I04	8.32e-31	129	510	0.130	0.171	Q66I04_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:92124 PE=2 SV=1
18	G5ECJ6	1.17e-30	129	539	0.122	0.152	CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans OX=6239 GN=csk-1 PE=1 SV=1
19	A0A178UNT9	1.26e-30	129	525	0.119	0.152	A0A178UNT9_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At5g58950 PE=1 SV=1
20	Q54TM7	1.52e-30	130	1288	0.119	0.062	DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum OX=44689 GN=drkD PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	19	15.8	ABC1 atypical kinase-like domain
2	PF00531 Death	1.4e-19	81.3	Death domain
3	PF06293 Kdo	89	13.9	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	71	14.2	Kinase-like
5	PF00069 Pkinase	5.3e-48	175.3	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	3.7e-49	178.9	Protein tyrosine and serine/threonine kinase
7	PF12721 RHIM	0.58	20.9	RIP homotypic interaction motif
8	PF01163 RIO1	39	15.3	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259808

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.999	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000247668	0.999	TNF receptor-associated factor 2
3	9606.ENSP00000301838	0.999	FAS-associated death domain protein
4	9606.ENSP00000341268	0.999	Tumor necrosis factor receptor type 1-associated DEATH domain protein
5	9606.ENSP00000351273	0.999	Caspase-8
6	9606.ENSP00000356426	0.999	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
7	9606.ENSP00000477613	0.999	Baculoviral IAP repeat-containing protein 2
8	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
9	9606.ENSP00000248244	0.998	TIR domain-containing adapter molecule 1
10	9606.ENSP00000263464	0.998	Baculoviral IAP repeat-containing protein 3
11	9606.ENSP00000312455	0.998	CASP8 and FADD-like apoptosis regulator
12	9606.ENSP00000398698	0.998	Tumor necrosis factor
13	9606.ENSP00000216274	0.997	Receptor-interacting serine/threonine-protein kinase 3
14	9606.ENSP00000392025	0.997	Ubiquitin carboxyl-terminal hydrolase CYLD
15	9606.ENSP00000433623	0.995	TNF receptor-associated factor 6
16	9606.ENSP00000335153	0.994	Heat shock protein HSP 90-alpha
17	9606.ENSP00000481570	0.994	Tumor necrosis factor alpha-induced protein 3
18	9606.ENSP00000286186	0.993	Caspase-10
19	9606.ENSP00000374455	0.991	Sequestosome-1
20	9606.ENSP00000358335	0.989	Mitogen-activated protein kinase kinase kinase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005123	0.999	death receptor binding
GO:0044877	0.998	protein-containing complex binding
GO:0019899	0.993	enzyme binding
GO:0044389	0.933	ubiquitin-like protein ligase binding
GO:0031625	0.746	ubiquitin protein ligase binding
GO:0019904	0.694	protein domain specific binding
GO:0070513	0.380	death domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.989	positive regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0048583	0.984	regulation of response to stimulus
GO:0044238	0.979	primary metabolic process
GO:0019222	0.978	regulation of metabolic process
GO:1901564	0.978	organonitrogen compound metabolic process
GO:0007165	0.978	signal transduction
GO:0048584	0.974	positive regulation of response to stimulus
GO:0031323	0.973	regulation of cellular metabolic process
GO:0043170	0.972	macromolecule metabolic process
GO:0009966	0.972	regulation of signal transduction
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0010942	0.965	positive regulation of cell death
GO:0036211	0.960	protein modification process
GO:0043068	0.958	positive regulation of programmed cell death
GO:0048519	0.957	negative regulation of biological process
GO:0042221	0.937	response to chemical
GO:0051090	0.934	regulation of DNA-binding transcription factor activity
GO:0043122	0.931	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010939	0.928	regulation of necrotic cell death
GO:0009893	0.918	positive regulation of metabolic process
GO:0043123	0.914	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048523	0.903	negative regulation of cellular process
GO:0051091	0.902	positive regulation of DNA-binding transcription factor activity
GO:2001233	0.895	regulation of apoptotic signaling pathway
GO:0006796	0.887	phosphate-containing compound metabolic process
GO:0051092	0.880	positive regulation of NF-kappaB transcription factor activity
GO:0060759	0.866	regulation of response to cytokine stimulus
GO:0043065	0.859	positive regulation of apoptotic process
GO:0006468	0.848	protein phosphorylation
GO:0031347	0.844	regulation of defense response
GO:0043408	0.839	regulation of MAPK cascade
GO:0031349	0.821	positive regulation of defense response
GO:0008219	0.820	cell death
GO:2001235	0.807	positive regulation of apoptotic signaling pathway
GO:0051174	0.802	regulation of phosphorus metabolic process
GO:0010604	0.801	positive regulation of macromolecule metabolic process
GO:2001236	0.797	regulation of extrinsic apoptotic signaling pathway
GO:0032101	0.779	regulation of response to external stimulus
GO:0001959	0.779	regulation of cytokine-mediated signaling pathway
GO:0012501	0.774	programmed cell death
GO:0032103	0.772	positive regulation of response to external stimulus
GO:0051239	0.769	regulation of multicellular organismal process
GO:0043410	0.763	positive regulation of MAPK cascade
GO:0031325	0.750	positive regulation of cellular metabolic process
GO:0070265	0.749	necrotic cell death
GO:0060548	0.733	negative regulation of cell death
GO:2001238	0.727	positive regulation of extrinsic apoptotic signaling pathway
GO:0050727	0.720	regulation of inflammatory response
GO:0060760	0.702	positive regulation of response to cytokine stimulus
GO:0010033	0.695	response to organic substance
GO:0032872	0.695	regulation of stress-activated MAPK cascade
GO:0006915	0.684	apoptotic process
GO:0002682	0.674	regulation of immune system process
GO:0001961	0.659	positive regulation of cytokine-mediated signaling pathway
GO:0051173	0.649	positive regulation of nitrogen compound metabolic process
GO:0043069	0.638	negative regulation of programmed cell death
GO:0001817	0.634	regulation of cytokine production
GO:0002684	0.625	positive regulation of immune system process
GO:0070887	0.610	cellular response to chemical stimulus
GO:0007166	0.607	cell surface receptor signaling pathway
GO:0010628	0.601	positive regulation of gene expression
GO:0046777	0.597	protein autophosphorylation
GO:2000377	0.583	regulation of reactive oxygen species metabolic process
GO:0071310	0.573	cellular response to organic substance
GO:0051240	0.563	positive regulation of multicellular organismal process
GO:0071840	0.548	cellular component organization or biogenesis
GO:0051246	0.537	regulation of protein metabolic process
GO:0051247	0.517	positive regulation of protein metabolic process
GO:0048585	0.516	negative regulation of response to stimulus
GO:0070304	0.516	positive regulation of stress-activated protein kinase signaling cascade
GO:0016043	0.509	cellular component organization
GO:0019220	0.509	regulation of phosphate metabolic process
GO:0043066	0.492	negative regulation of apoptotic process
GO:0042325	0.479	regulation of phosphorylation
GO:0006950	0.464	response to stress
GO:0045937	0.461	positive regulation of phosphate metabolic process
GO:0009968	0.451	negative regulation of signal transduction
GO:0042327	0.451	positive regulation of phosphorylation
GO:0018193	0.446	peptidyl-amino acid modification
GO:0050793	0.417	regulation of developmental process
GO:0031399	0.414	regulation of protein modification process
GO:0018209	0.388	peptidyl-serine modification
GO:0009605	0.375	response to external stimulus
GO:0045935	0.314	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0012505	0.995	endomembrane system
GO:0043227	0.993	membrane-bounded organelle
GO:0032991	0.991	protein-containing complex
GO:0043229	0.977	intracellular organelle
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0005886	0.973	plasma membrane
GO:0031982	0.920	vesicle
GO:0031090	0.910	organelle membrane
GO:0097708	0.855	intracellular vesicle
GO:0031410	0.854	cytoplasmic vesicle
GO:0098588	0.778	bounding membrane of organelle
GO:0005634	0.516	nucleus
GO:0005768	0.410	endosome
GO:0030659	0.385	cytoplasmic vesicle membrane
GO:0098796	0.384	membrane protein complex
GO:1902494	0.345	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]