StarFunc result for job id Q13547

User Input

>input (482 residues)
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O09106	0.879	0.879	5.184E-93	482	0.994	0.994	O09106.pdb.gz	HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus OX=10090 GN=Hdac1 PE=1 SV=1
2	AFDB:A0A2R8QIW0	0.871	0.867	8.579E-90	484	0.900	0.897	A0A2R8QIW0.pdb.gz	A0A2R8QIW0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=chunp6919 PE=1 SV=1
3	AFDB:B1WBY8	0.811	0.717	5.153E-84	546	0.857	0.756	B1WBY8.pdb.gz	B1WBY8_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=2 SV=1
4	AFDB:P56518	0.886	0.743	7.753E-84	576	0.788	0.660	P56518.pdb.gz	HDAC1_STRPU Histone deacetylase 1 OS=Strongylocentrotus purpuratus OX=7668 GN=HDAC1 PE=2 SV=1
5	AFDB:Q94517	0.891	0.825	1.920E-82	521	0.757	0.701	Q94517.pdb.gz	HDAC1_DROME Histone deacetylase HDAC1 OS=Drosophila melanogaster OX=7227 GN=HDAC1 PE=1 SV=2
6	AFDB:Q6P2A8	0.730	0.770	2.517E-79	457	0.846	0.893	Q6P2A8.pdb.gz
7	PDB:7zzuB	0.766	0.994	1.202E-74	371	0.716	0.930	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
8	AFDB:O17695	0.866	0.905	1.472E-72	461	0.604	0.631	O17695.pdb.gz	HDA1_CAEEL Histone deacetylase 1 OS=Caenorhabditis elegans OX=6239 GN=hda-1 PE=1 SV=1
9	AFDB:O22446	0.818	0.787	1.359E-69	501	0.579	0.557	O22446.pdb.gz	HDA19_ARATH Histone deacetylase 19 OS=Arabidopsis thaliana OX=3702 GN=HDA19 PE=1 SV=2
10	AFDB:G5ECH0	0.850	0.880	3.261E-69	465	0.573	0.594	G5ECH0.pdb.gz	G5ECH0_CAEEL Histone deacetylase OS=Caenorhabditis elegans OX=6239 GN=hda-3 PE=1 SV=1
11	AFDB:Q5ADP0	0.859	0.719	9.323E-69	577	0.554	0.463	Q5ADP0.pdb.gz	Q5ADP0_CANAL histone deacetylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPD31 PE=1 SV=1
12	PDB:3sfhA	0.677	0.948	2.277E-41	342	0.301	0.424	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
13	PDB:4qa0A	0.739	0.955	2.559E-41	371	0.309	0.402	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
14	PDB:5g0yB	0.621	0.785	8.568E-25	377	0.183	0.233	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
15	PDB:7sggA	0.596	0.451	6.433E-23	644	0.156	0.116	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
16	PDB:5eduB	0.622	0.421	9.679E-23	723	0.174	0.116	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
17	PDB:6z6fB	0.612	0.454	3.824E-21	661	0.193	0.141	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
18	PDB:6uijA	0.598	0.470	6.675E-20	620	0.154	0.119	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
19	PDB:5ikkA	0.526	0.433	1.698E-19	594	0.158	0.128	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
20	PDB:5zeeB	0.286	0.427	2.579E-4	297	0.060	0.098	5zeeB.pdb.gz	Structural insights into Entamoeba histolytica arginase and structure-based identification of novel non-amino acid based inhibitors as potential antiamoebic molecules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PSA6	563	480	0.550	0.552	A0A1D8PSA6_CANAL Histone deacetylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPD3 PE=3 SV=1
2	A0A2R8QIW0	855	484	0.851	0.847	A0A2R8QIW0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=chunp6919 PE=1 SV=1
3	A0A8I6AP99	837	471	0.842	0.862	A0A8I6AP99_RAT Histone deacetylase 2 OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=1 SV=1
4	B1WBY8	848	546	0.857	0.756	B1WBY8_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=2 SV=1
5	F7ENH8	851	488	0.857	0.846	F7ENH8_RAT Histone deacetylase 2 OS=Rattus norvegicus OX=10116 GN=Hdac2 PE=1 SV=1
6	G5EB64	607	687	0.581	0.408	G5EB64_EMENI histone deacetylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04493 PE=3 SV=1
7	G5ECH0	613	465	0.571	0.591	G5ECH0_CAEEL Histone deacetylase OS=Caenorhabditis elegans OX=6239 GN=hda-3 PE=1 SV=1
8	O09106	1004	482	0.994	0.994	HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus OX=10090 GN=Hdac1 PE=1 SV=1
9	O15379	553	428	0.504	0.568	HDAC3_HUMAN Histone deacetylase 3 OS=Homo sapiens OX=9606 GN=HDAC3 PE=1 SV=2
10	O17695	643	461	0.602	0.629	HDA1_CAEEL Histone deacetylase 1 OS=Caenorhabditis elegans OX=6239 GN=hda-1 PE=1 SV=1
11	O22446	576	501	0.554	0.533	HDA19_ARATH Histone deacetylase 19 OS=Arabidopsis thaliana OX=3702 GN=HDA19 PE=1 SV=2
12	O59702	556	405	0.517	0.615	CLR6_SCHPO Histone deacetylase clr6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr6 PE=1 SV=1
13	O88895	555	428	0.506	0.570	HDAC3_MOUSE Histone deacetylase 3 OS=Mus musculus OX=10090 GN=Hdac3 PE=1 SV=2
14	P32561	568	433	0.523	0.582	RPD3_YEAST Histone deacetylase RPD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPD3 PE=1 SV=1
15	P56517	884	480	0.913	0.917	HDAC1_CHICK Histone deacetylase 1 OS=Gallus gallus OX=9031 GN=HDAC1 PE=2 SV=1
16	P56518	803	576	0.807	0.675	HDAC1_STRPU Histone deacetylase 1 OS=Strongylocentrotus purpuratus OX=7668 GN=HDAC1 PE=2 SV=1
17	P56519	832	488	0.846	0.836	HDAC2_CHICK Histone deacetylase 2 OS=Gallus gallus OX=9031 GN=HDAC2 PE=2 SV=1
18	P56520	560	428	0.517	0.582	HDAC3_CHICK Histone deacetylase 3 OS=Gallus gallus OX=9031 GN=HDAC3 PE=2 SV=1
19	P70288	850	488	0.859	0.848	HDAC2_MOUSE Histone deacetylase 2 OS=Mus musculus OX=10090 GN=Hdac2 PE=1 SV=1
20	Q13547	1008	482	1.000	1.000	HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00850 Hist_deacetyl	5e-84	293.9	Histone deacetylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362649

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244050	0.999	Zinc finger protein SNAI1
2	9606.ENSP00000256429	0.999	Methyl-CpG-binding domain protein 2
3	9606.ENSP00000262133	0.999	Retinoblastoma-like protein 2
4	9606.ENSP00000262238	0.999	Transcriptional repressor protein YY1
5	9606.ENSP00000262241	0.999	REST corepressor 1
6	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
7	9606.ENSP00000267163	0.999	Retinoblastoma-associated protein
8	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
9	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
10	9606.ENSP00000278823	0.999	Metastasis-associated protein MTA2
11	9606.ENSP00000290921	0.999	C-terminal-binding protein 1
12	9606.ENSP00000296504	0.999	Histone deacetylase complex subunit SAP30
13	9606.ENSP00000320147	0.999	Histone-lysine N-methyltransferase EZH2
14	9606.ENSP00000329357	0.999	Transcription factor Sp1
15	9606.ENSP00000333633	0.999	Metastasis-associated protein MTA1
16	9606.ENSP00000344456	0.999	Catenin beta-1
17	9606.ENSP00000349508	0.999	Chromodomain-helicase-DNA-binding protein 4
18	9606.ENSP00000352516	0.999	DNA (cytosine-5)-methyltransferase 1
19	9606.ENSP00000362592	0.999	Histone-binding protein RBBP4
20	9606.ENSP00000369131	0.999	Paired amphipathic helix protein Sin3b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	1.000	transcription corepressor activity
GO:0004407	1.000	histone deacetylase activity
GO:0140297	0.999	DNA-binding transcription factor binding
GO:0061629	0.789	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003682	0.699	chromatin binding
GO:0097159	0.645	organic cyclic compound binding
GO:0003676	0.641	nucleic acid binding
GO:0003677	0.577	DNA binding
GO:0043565	0.529	sequence-specific DNA binding
GO:0003690	0.387	double-stranded DNA binding
GO:1990837	0.342	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0048519	0.976	negative regulation of biological process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0010468	0.967	regulation of gene expression
GO:0010556	0.965	regulation of macromolecule biosynthetic process
GO:0031326	0.965	regulation of cellular biosynthetic process
GO:0019219	0.965	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.945	regulation of RNA metabolic process
GO:0006355	0.889	regulation of DNA-templated transcription
GO:0048523	0.878	negative regulation of cellular process
GO:0009892	0.810	negative regulation of metabolic process
GO:0010605	0.750	negative regulation of macromolecule metabolic process
GO:1903507	0.669	negative regulation of nucleic acid-templated transcription
GO:0045892	0.658	negative regulation of DNA-templated transcription
GO:0048518	0.625	positive regulation of biological process
GO:0048522	0.501	positive regulation of cellular process
GO:0071840	0.455	cellular component organization or biogenesis
GO:0071704	0.422	organic substance metabolic process
GO:0006357	0.413	regulation of transcription by RNA polymerase II
GO:0016043	0.405	cellular component organization
GO:0044238	0.378	primary metabolic process
GO:0050896	0.361	response to stimulus
GO:0006807	0.355	nitrogen compound metabolic process
GO:0043170	0.345	macromolecule metabolic process
GO:0009893	0.337	positive regulation of metabolic process
GO:0042127	0.334	regulation of cell population proliferation
GO:0010604	0.331	positive regulation of macromolecule metabolic process
GO:0051239	0.325	regulation of multicellular organismal process
GO:0051173	0.303	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:1902494	0.982	catalytic complex
GO:0140513	0.982	nuclear protein-containing complex
GO:0005694	0.965	chromosome
GO:0000785	0.964	chromatin
GO:0000118	0.860	histone deacetylase complex
GO:0005829	0.357	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.

[back to server]