StarFunc result for job id Q13554

User Input

>input (666 residues)
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSP
ALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13554	1.000	1.000	0.000	666	1.000	1.000	Q13554.pdb.gz	KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B PE=1 SV=3
2	AFDB:P08413	0.696	0.852	6.943E-89	542	0.806	0.991	P08413.pdb.gz	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
3	AFDB:A2BGW3	0.701	0.755	3.578E-87	618	0.764	0.824	A2BGW3.pdb.gz
4	AFDB:A0A0R4IQT3	0.668	0.699	5.265E-83	637	0.724	0.757	A0A0R4IQT3.pdb.gz
5	AFDB:Q4V9P8	0.702	0.834	2.250E-82	560	0.703	0.836	Q4V9P8.pdb.gz	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
6	AFDB:Q13555	0.707	0.842	2.769E-82	558	0.688	0.821	Q13555.pdb.gz	KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G PE=1 SV=4
7	AFDB:F1QW17	0.657	0.743	4.801E-81	587	0.716	0.813	F1QW17.pdb.gz	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
8	AFDB:P15791	0.699	0.871	9.235E-80	533	0.656	0.820	P15791.pdb.gz	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
9	AFDB:Q923T9	0.701	0.878	5.976E-79	529	0.662	0.834	Q923T9.pdb.gz	KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus OX=10090 GN=Camk2g PE=1 SV=1
10	AFDB:A0A286YAD2	0.628	0.741	5.071E-76	562	0.659	0.781	A0A286YAD2.pdb.gz
11	PDB:5u6yA	0.425	0.614	2.257E-64	459	0.577	0.837	5u6yA.pdb.gz
12	PDB:3soaA	0.617	0.926	1.678E-57	436	0.554	0.846	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
13	PDB:8bfsA	0.372	0.865	3.117E-26	274	0.170	0.412	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
14	PDB:2yaaA	0.394	0.849	1.782E-24	300	0.158	0.350	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:4rgjA	0.377	0.528	1.019E-22	463	0.164	0.235	4rgjA.pdb.gz
16	PDB:5ufuA	0.363	0.641	1.512E-21	369	0.144	0.260	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
17	PDB:7myjC	0.359	0.506	2.290E-21	465	0.153	0.219	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
18	PDB:4zhxA	0.361	0.577	2.540E-21	409	0.153	0.249	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:6b1uA	0.362	0.536	3.847E-21	442	0.149	0.224	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:4d28C	0.339	0.769	1.309E-19	279	0.156	0.373	4d28C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QDQ2	0.0	704	531	0.556	0.697	E9QDQ2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=CAMK2Gb PE=1 SV=2
2	F1QW17	0.0	692	587	0.529	0.600	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
3	G5EDZ5	0.0	532	681	0.408	0.399	G5EDZ5_CAEEL calcium/calmodulin-dependent protein kinase OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=1
4	P08413	0.0	848	542	0.620	0.762	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
5	P11275	0.0	616	478	0.461	0.642	KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus OX=10116 GN=Camk2a PE=1 SV=1
6	P11730	0.0	667	527	0.512	0.647	KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus OX=10116 GN=Camk2g PE=1 SV=1
7	P11798	0.0	616	478	0.461	0.642	KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2
8	P15791	0.0	674	533	0.517	0.645	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
9	P28652	0.0	848	542	0.620	0.762	KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus OX=10090 GN=Camk2b PE=1 SV=2
10	Q00168	0.0	582	530	0.434	0.545	KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster OX=7227 GN=CaMKII PE=1 SV=1
11	Q13554	0.0	1381	666	1.000	1.000	KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B PE=1 SV=3
12	Q13555	0.0	671	558	0.512	0.611	KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G PE=1 SV=4
13	Q13557	0.0	628	499	0.483	0.645	KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3
14	Q32PV2	0.0	612	478	0.465	0.649	Q32PV2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=zgc:123320 PE=1 SV=1
15	Q4V9P8	0.0	675	560	0.502	0.596	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
16	Q6PHZ2	0.0	628	499	0.483	0.645	KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus OX=10090 GN=Camk2d PE=1 SV=1
17	Q923T9	0.0	665	529	0.505	0.635	KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus OX=10090 GN=Camk2g PE=1 SV=1
18	Q9UQM7	0.0	617	478	0.461	0.642	KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens OX=9606 GN=CAMK2A PE=1 SV=2
19	O62305	1.48e-179	529	720	0.375	0.347	KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=2
20	A5D7B9	1.61e-83	284	908	0.215	0.157	A5D7B9_BOVIN CASK protein OS=Bos taurus OX=9913 GN=CASK PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	1.9	19.8	Phosphotransferase enzyme family
2	PF08332 CaMKII_AD	5.5e-56	199.6	Calcium/calmodulin dependent protein kinase II association domain
3	PF14534 DUF4440	2.7e-08	45.6	Domain of unknown function (DUF4440)
4	PF06293 Kdo	55	14.6	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF00069 Pkinase	6.8e-70	247.0	Protein kinase domain
6	PF17667 Pkinase_fungal	33	14.7	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	1.1e-28	111.8	Protein tyrosine and serine/threonine kinase
8	PF12680 SnoaL_2	2.3	20.3	SnoaL-like domain
9	PF13474 SnoaL_3	6.4e-07	41.1	SnoaL-like domain
10	PF13577 SnoaL_4	3.3e+02	12.7	SnoaL-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379098

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339740	0.996	Calcium/calmodulin-dependent protein kinase type II subunit delta
2	9606.ENSP00000381412	0.996	Calcium/calmodulin-dependent protein kinase type II subunit alpha
3	9606.ENSP00000272298	0.979	Calmodulin 2 (phosphorylase kinase, delta)
4	9606.ENSP00000291295	0.978	Calmodulin 3 (phosphorylase kinase, delta)
5	9606.ENSP00000382428	0.967	Disks large homolog 4
6	9606.ENSP00000296526	0.964	Glutamate receptor 2
7	9606.ENSP00000349467	0.963	Calmodulin-1
8	9606.ENSP00000428994	0.955	Glutamate receptor 1
9	9606.ENSP00000319060	0.953	Calcium/calmodulin-dependent protein kinase type II subunit gamma
10	9606.ENSP00000481554	0.948	Glutamate receptor 3
11	9606.ENSP00000282499	0.946	Glutamate receptor 4
12	9606.ENSP00000340820	0.940	Microtubule-associated protein tau
13	9606.ENSP00000005284	0.938	Voltage-dependent calcium channel gamma-3 subunit
14	9606.ENSP00000378323	0.938	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
15	9606.ENSP00000378306	0.933	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
16	9606.ENSP00000361930	0.929	14-3-3 protein beta/alpha
17	9606.ENSP00000387699	0.927	Cyclic AMP-responsive element-binding protein 1
18	9606.ENSP00000430432	0.927	Histone deacetylase 2
19	9606.ENSP00000350170	0.925	Fragile X mental retardation syndrome-related protein 1
20	9606.ENSP00000262138	0.921	Voltage-dependent calcium channel gamma-4 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0046983	0.998	protein dimerization activity
GO:0042802	0.996	identical protein binding
GO:0042803	0.994	protein homodimerization activity
GO:0010857	0.981	calcium-dependent protein kinase activity
GO:0009931	0.884	calcium-dependent protein serine/threonine kinase activity
GO:0004683	0.800	calmodulin-dependent protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008152	0.995	metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0071704	0.977	organic substance metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0043170	0.963	macromolecule metabolic process
GO:0006793	0.955	phosphorus metabolic process
GO:0050896	0.951	response to stimulus
GO:0043412	0.950	macromolecule modification
GO:0044238	0.915	primary metabolic process
GO:1901564	0.907	organonitrogen compound metabolic process
GO:0016310	0.904	phosphorylation
GO:0006468	0.888	protein phosphorylation
GO:0023052	0.692	signaling
GO:0007154	0.692	cell communication
GO:0051716	0.684	cellular response to stimulus
GO:0046777	0.553	protein autophosphorylation
GO:0007165	0.460	signal transduction
GO:0048518	0.355	positive regulation of biological process
GO:0010646	0.335	regulation of cell communication
GO:0048522	0.329	positive regulation of cellular process
GO:0023051	0.322	regulation of signaling
GO:0048583	0.314	regulation of response to stimulus
GO:0032879	0.302	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.994	nucleus
GO:0031981	0.980	nuclear lumen
GO:0016020	0.979	membrane
GO:0005829	0.977	cytosol
GO:0005654	0.974	nucleoplasm
GO:0005886	0.949	plasma membrane
GO:0032991	0.924	protein-containing complex
GO:0031982	0.879	vesicle
GO:0031090	0.722	organelle membrane
GO:0097708	0.699	intracellular vesicle
GO:0031410	0.688	cytoplasmic vesicle
GO:0098588	0.550	bounding membrane of organelle
GO:1902494	0.411	catalytic complex
GO:0012506	0.411	vesicle membrane
GO:0030659	0.400	cytoplasmic vesicle membrane
GO:0030139	0.395	endocytic vesicle
GO:0030666	0.348	endocytic vesicle membrane
GO:0140535	0.304	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.17	0.800	calcium/calmodulin-dependent protein kinase.

[back to server]