StarFunc result for job id Q13555

User Input

>input (558 residues)
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPL
QTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKGRVPEGRSSRDRTAPSAGMQPQPSL
CSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFE
NLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDG
KWLNVHYHCSGAPAAPLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13555	1.000	1.000	7.605E-100	558	1.000	1.000	Q13555.pdb.gz	KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G PE=1 SV=4
2	AFDB:Q923T9	0.877	0.924	1.680E-91	529	0.934	0.985	Q923T9.pdb.gz	KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus OX=10090 GN=Camk2g PE=1 SV=1
3	AFDB:Q4V9P8	0.859	0.856	2.687E-89	560	0.857	0.854	Q4V9P8.pdb.gz	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
4	AFDB:A0A0R4IQT3	0.800	0.702	1.699E-85	637	0.887	0.777	A0A0R4IQT3.pdb.gz
5	AFDB:F1QW17	0.790	0.752	3.439E-82	587	0.862	0.819	F1QW17.pdb.gz	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
6	AFDB:A2BGW3	0.844	0.762	1.466E-81	618	0.828	0.748	A2BGW3.pdb.gz
7	AFDB:P08413	0.836	0.860	1.626E-81	542	0.790	0.814	P08413.pdb.gz	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
8	AFDB:Q13554	0.836	0.703	4.131E-81	666	0.835	0.700	Q13554.pdb.gz	KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B PE=1 SV=3
9	AFDB:P15791	0.843	0.881	8.769E-80	533	0.778	0.814	P15791.pdb.gz	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
10	AFDB:A0A2R8QIR1	0.772	0.822	2.602E-79	523	0.772	0.824	A0A2R8QIR1.pdb.gz
11	PDB:5u6yA	0.514	0.623	9.249E-67	459	0.690	0.839	5u6yA.pdb.gz
12	PDB:3soaA	0.723	0.915	5.894E-59	436	0.656	0.839	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
13	PDB:8bfsA	0.442	0.869	8.126E-27	274	0.204	0.416	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
14	PDB:2yaaA	0.475	0.866	5.677E-25	300	0.197	0.367	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:4rgjA	0.438	0.522	1.448E-22	463	0.188	0.227	4rgjA.pdb.gz
16	PDB:7myjC	0.426	0.508	1.781E-22	465	0.206	0.247	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
17	PDB:6b1uA	0.430	0.538	2.252E-21	442	0.170	0.215	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:4zhxA	0.430	0.579	4.416E-21	409	0.192	0.262	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:5ufuA	0.432	0.643	5.721E-21	369	0.167	0.252	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:6byrA	0.429	0.582	1.153E-19	405	0.156	0.215	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QDQ2	0.0	883	531	0.789	0.829	E9QDQ2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=CAMK2Gb PE=1 SV=2
2	F1QW17	0.0	966	587	0.864	0.821	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
3	G5EDZ5	0.0	681	681	0.613	0.502	G5EDZ5_CAEEL calcium/calmodulin-dependent protein kinase OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=1
4	O62305	0.0	532	720	0.466	0.361	KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=2
5	P08413	0.0	922	542	0.812	0.836	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
6	P11275	0.0	822	478	0.715	0.835	KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus OX=10116 GN=Camk2a PE=1 SV=1
7	P11730	0.0	1020	527	0.901	0.954	KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus OX=10116 GN=Camk2g PE=1 SV=1
8	P11798	0.0	822	478	0.715	0.835	KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2
9	P15791	0.0	895	533	0.783	0.820	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
10	P28652	0.0	924	542	0.814	0.838	KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus OX=10090 GN=Camk2b PE=1 SV=2
11	Q00168	0.0	788	530	0.690	0.726	KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster OX=7227 GN=CaMKII PE=1 SV=1
12	Q13554	0.0	671	666	0.611	0.512	KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B PE=1 SV=3
13	Q13555	0.0	1174	558	1.000	1.000	KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G PE=1 SV=4
14	Q13557	0.0	862	499	0.756	0.846	KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3
15	Q32PV2	0.0	815	478	0.710	0.828	Q32PV2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=zgc:123320 PE=1 SV=1
16	Q4V9P8	0.0	980	560	0.864	0.861	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
17	Q6PHZ2	0.0	862	499	0.756	0.846	KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus OX=10090 GN=Camk2d PE=1 SV=1
18	Q923T9	0.0	1095	529	0.946	0.998	KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus OX=10090 GN=Camk2g PE=1 SV=1
19	Q9UQM7	0.0	823	478	0.717	0.837	KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens OX=9606 GN=CAMK2A PE=1 SV=2
20	A5D7B9	2.50e-85	285	908	0.253	0.155	A5D7B9_BOVIN CASK protein OS=Bos taurus OX=9913 GN=CASK PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.1e+02	13.4	ABC1 atypical kinase-like domain
2	PF01636 APH	3	19.2	Phosphotransferase enzyme family
3	PF08332 CaMKII_AD	1.7e-56	201.3	Calcium/calmodulin dependent protein kinase II association domain
4	PF14534 DUF4440	2.8e-07	42.3	Domain of unknown function (DUF4440)
5	PF13095 FTA2	46	15.1	Kinetochore Sim4 complex subunit FTA2
6	PF06293 Kdo	23	15.8	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF00069 Pkinase	3.2e-71	251.4	Protein kinase domain
8	PF17667 Pkinase_fungal	14	15.9	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	2.4e-31	120.5	Protein tyrosine and serine/threonine kinase
10	PF01163 RIO1	3.2e+02	12.3	RIO1 family
11	PF12680 SnoaL_2	32	16.6	SnoaL-like domain
12	PF13474 SnoaL_3	4.1e-07	41.8	SnoaL-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000005221

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007782	0.982	Calcium/calmodulin-dependent protein kinase II alpha
2	60711.ENSCSAP00000011686	0.981	Calcium/calmodulin-dependent protein kinase II beta
3	60711.ENSCSAP00000007065	0.956	Glutamate receptor, ionotropic, AMPA 1
4	60711.ENSCSAP00000000143	0.942	Microtubule-associated protein tau
5	60711.ENSCSAP00000014802	0.930	Glutamate receptor, ionotropic, AMPA 2
6	60711.ENSCSAP00000008380	0.924	Signal transducer and activator of transcription 1, 91kDa
7	60711.ENSCSAP00000000163	0.914	Calcium/calmodulin-dependent protein kinase II delta
8	60711.ENSCSAP00000007641	0.905	Calmodulin 1 (phosphorylase kinase, delta)
9	60711.ENSCSAP00000010095	0.889	Phospholipase C, gamma 1
10	60711.ENSCSAP00000014625	0.889	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
11	60711.ENSCSAP00000005921	0.884	Ryanodine receptor 2 (cardiac)
12	60711.ENSCSAP00000013172	0.881	annotation not available
13	60711.ENSCSAP00000006347	0.876	cAMP responsive element binding protein 1
14	60711.ENSCSAP00000000487	0.875	Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit (By similarity). Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs), including GRIA1 and GRIA4. Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization
15	60711.ENSCSAP00000016116	0.875	Regulates the trafficking and gating properties of AMPA- selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits.
16	60711.ENSCSAP00000004776	0.873	Glutamate receptor, ionotropic, N-methyl D-aspartate 2B
17	60711.ENSCSAP00000003059	0.872	Filamin A, alpha
18	60711.ENSCSAP00000003062	0.862	Nitric oxide synthase 3 (endothelial cell)
19	60711.ENSCSAP00000006321	0.862	Adenylate cyclase 8 (brain)
20	60711.ENSCSAP00000004146	0.858	Regulates the trafficking and gating properties of AMPA- selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004683	1.000	calmodulin-dependent protein kinase activity
GO:0005515	0.999	protein binding
GO:0042802	0.678	identical protein binding
GO:0046983	0.445	protein dimerization activity
GO:0042803	0.424	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0006796	0.985	phosphate-containing compound metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.976	response to stimulus
GO:0016310	0.966	phosphorylation
GO:0071704	0.962	organic substance metabolic process
GO:0043412	0.944	macromolecule modification
GO:0044238	0.911	primary metabolic process
GO:1901564	0.885	organonitrogen compound metabolic process
GO:0036211	0.876	protein modification process
GO:0032501	0.864	multicellular organismal process
GO:0023052	0.778	signaling
GO:0007154	0.762	cell communication
GO:0051716	0.718	cellular response to stimulus
GO:0048518	0.667	positive regulation of biological process
GO:0051239	0.666	regulation of multicellular organismal process
GO:0051128	0.637	regulation of cellular component organization
GO:0065008	0.631	regulation of biological quality
GO:0032502	0.623	developmental process
GO:0006468	0.612	protein phosphorylation
GO:0048522	0.583	positive regulation of cellular process
GO:0048856	0.560	anatomical structure development
GO:0007275	0.516	multicellular organism development
GO:0007165	0.511	signal transduction
GO:0051179	0.488	localization
GO:0032879	0.488	regulation of localization
GO:0048583	0.477	regulation of response to stimulus
GO:0044057	0.476	regulation of system process
GO:0051049	0.464	regulation of transport
GO:0023051	0.446	regulation of signaling
GO:0043269	0.442	regulation of monoatomic ion transport
GO:0010646	0.434	regulation of cell communication
GO:0048731	0.427	system development
GO:0065009	0.389	regulation of molecular function
GO:0019222	0.382	regulation of metabolic process
GO:0051234	0.352	establishment of localization
GO:0006810	0.333	transport
GO:0042221	0.317	response to chemical
GO:0060255	0.310	regulation of macromolecule metabolic process
GO:0051171	0.308	regulation of nitrogen compound metabolic process
GO:0071840	0.307	cellular component organization or biogenesis
GO:0048869	0.307	cellular developmental process
GO:0048519	0.304	negative regulation of biological process
GO:0016043	0.304	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043226	0.983	organelle
GO:0043229	0.970	intracellular organelle
GO:0043227	0.969	membrane-bounded organelle
GO:0005634	0.955	nucleus
GO:0005829	0.942	cytosol
GO:0016020	0.834	membrane
GO:0005654	0.762	nucleoplasm
GO:0098794	0.615	postsynapse
GO:0032279	0.598	asymmetric synapse
GO:0014069	0.565	postsynaptic density
GO:0042995	0.450	cell projection
GO:0120025	0.396	plasma membrane bounded cell projection
GO:0032991	0.391	protein-containing complex
GO:0043005	0.377	neuron projection
GO:0012506	0.336	vesicle membrane
GO:0030139	0.336	endocytic vesicle
GO:0030659	0.334	cytoplasmic vesicle membrane
GO:0030666	0.322	endocytic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.17	1.000	calcium/calmodulin-dependent protein kinase.

[back to server]