StarFunc result for job id Q13557

User Input

>input (499 residues)
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
CIPNGKENFSGGTSLWQNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13557	1.000	1.000	3.953E-92	499	1.000	1.000	Q13557.pdb.gz	KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3
2	AFDB:P15791	0.947	0.887	8.452E-87	533	0.992	0.929	P15791.pdb.gz	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
3	AFDB:E7F2G0	0.938	0.979	1.139E-80	478	0.824	0.860	E7F2G0.pdb.gz
4	AFDB:P08413	0.901	0.831	5.832E-78	542	0.844	0.777	P08413.pdb.gz	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
5	AFDB:Q923T9	0.893	0.843	1.622E-77	529	0.840	0.792	Q923T9.pdb.gz	KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus OX=10090 GN=Camk2g PE=1 SV=1
6	AFDB:F1QW17	0.885	0.754	3.671E-76	587	0.816	0.693	F1QW17.pdb.gz	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
7	AFDB:A2BGW3	0.875	0.711	3.863E-76	618	0.828	0.668	A2BGW3.pdb.gz
8	AFDB:Q13555	0.869	0.779	1.318E-75	558	0.834	0.746	Q13555.pdb.gz	KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G PE=1 SV=4
9	AFDB:Q4V9P8	0.870	0.779	2.313E-75	560	0.820	0.730	Q4V9P8.pdb.gz	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
10	AFDB:A0A0R4IQT3	0.878	0.691	6.770E-75	637	0.814	0.637	A0A0R4IQT3.pdb.gz
11	PDB:5u6yA	0.575	0.624	1.298E-69	459	0.812	0.882	5u6yA.pdb.gz
12	PDB:3soaA	0.835	0.953	1.574E-61	436	0.770	0.881	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
13	PDB:8bfsA	0.495	0.875	1.159E-26	274	0.230	0.420	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
14	PDB:2yaaA	0.537	0.879	7.675E-25	300	0.228	0.380	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:7myjC	0.474	0.507	2.025E-23	465	0.234	0.252	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
16	PDB:6b1uA	0.480	0.539	1.152E-22	442	0.222	0.251	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:4zhxA	0.479	0.579	4.583E-22	409	0.216	0.264	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:5ufuA	0.481	0.642	8.909E-22	369	0.212	0.287	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:4rerA	0.480	0.520	1.039E-21	459	0.236	0.257	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:4rgjA	0.491	0.527	1.564E-21	463	0.232	0.251	4rgjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QDQ2	0.0	870	531	0.836	0.785	E9QDQ2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=CAMK2Gb PE=1 SV=2
2	F1QW17	0.0	835	587	0.832	0.707	F1QW17_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2g2 PE=1 SV=3
3	G5EDZ5	0.0	687	681	0.687	0.504	G5EDZ5_CAEEL calcium/calmodulin-dependent protein kinase OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=1
4	O62305	0.0	536	720	0.511	0.354	KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans OX=6239 GN=unc-43 PE=1 SV=2
5	P08413	0.0	874	542	0.844	0.777	KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus OX=10116 GN=Camk2b PE=1 SV=1
6	P11275	0.0	884	478	0.832	0.868	KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus OX=10116 GN=Camk2a PE=1 SV=1
7	P11730	0.0	872	527	0.840	0.795	KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus OX=10116 GN=Camk2g PE=1 SV=1
8	P11798	0.0	884	478	0.832	0.868	KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2
9	P15791	0.0	1025	533	0.992	0.929	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
10	P28652	0.0	877	542	0.846	0.779	KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus OX=10090 GN=Camk2b PE=1 SV=2
11	Q00168	0.0	809	530	0.774	0.728	KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster OX=7227 GN=CaMKII PE=1 SV=1
12	Q13554	0.0	627	666	0.645	0.483	KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B PE=1 SV=3
13	Q13555	0.0	864	558	0.844	0.754	KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G PE=1 SV=4
14	Q13557	0.0	1050	499	1.000	1.000	KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3
15	Q32PV2	0.0	875	478	0.822	0.858	Q32PV2_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=zgc:123320 PE=1 SV=1
16	Q4V9P8	0.0	850	560	0.838	0.746	Q4V9P8_DANRE calcium/calmodulin-dependent protein kinase OS=Danio rerio OX=7955 GN=camk2ga PE=1 SV=1
17	Q6PHZ2	0.0	1050	499	1.000	1.000	KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus OX=10090 GN=Camk2d PE=1 SV=1
18	Q923T9	0.0	879	529	0.844	0.796	KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus OX=10090 GN=Camk2g PE=1 SV=1
19	Q9UQM7	0.0	884	478	0.832	0.868	KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens OX=9606 GN=CAMK2A PE=1 SV=2
20	Q62915	2.25e-89	294	909	0.293	0.161	CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus OX=10116 GN=Cask PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	2.7	19.3	Phosphotransferase enzyme family
2	PF08332 CaMKII_AD	7.9e-57	202.4	Calcium/calmodulin dependent protein kinase II association domain
3	PF14534 DUF4440	4.8e-07	41.5	Domain of unknown function (DUF4440)
4	PF16261 DUF4915	5.2e+02	11.3	Domain of unknown function (DUF4915)
5	PF13095 FTA2	1.4e+02	13.6	Kinetochore Sim4 complex subunit FTA2
6	PF06293 Kdo	20	16.0	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF00069 Pkinase	5.2e-72	254.0	Protein kinase domain
8	PF17667 Pkinase_fungal	9.1	16.6	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	1.3e-28	111.6	Protein tyrosine and serine/threonine kinase
10	PF12680 SnoaL_2	33	16.6	SnoaL-like domain
11	PF13474 SnoaL_3	8.4e-06	37.5	SnoaL-like domain
12	PF13577 SnoaL_4	81	14.7	SnoaL-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339740

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379098	0.996	Calcium/calmodulin-dependent protein kinase type II subunit beta
2	9606.ENSP00000381412	0.996	Calcium/calmodulin-dependent protein kinase type II subunit alpha
3	9606.ENSP00000319060	0.987	Calcium/calmodulin-dependent protein kinase type II subunit gamma
4	9606.ENSP00000272298	0.982	Calmodulin 2 (phosphorylase kinase, delta)
5	9606.ENSP00000291295	0.965	Calmodulin 3 (phosphorylase kinase, delta)
6	9606.ENSP00000355533	0.941	Ryanodine receptor 2
7	9606.ENSP00000262138	0.936	Voltage-dependent calcium channel gamma-4 subunit
8	9606.ENSP00000282499	0.930	Glutamate receptor 4
9	9606.ENSP00000296526	0.929	Glutamate receptor 2
10	9606.ENSP00000428994	0.928	Glutamate receptor 1
11	9606.ENSP00000290219	0.925	Interferon gamma receptor 2
12	9606.ENSP00000350170	0.925	Fragile X mental retardation syndrome-related protein 1
13	9606.ENSP00000481554	0.925	Glutamate receptor 3
14	9606.ENSP00000225983	0.923	Histone deacetylase 5
15	9606.ENSP00000340820	0.923	Microtubule-associated protein tau
16	9606.ENSP00000354394	0.918	Signal transducer and activator of transcription 1-alpha/beta
17	9606.ENSP00000387699	0.918	Cyclic AMP-responsive element-binding protein 1
18	9606.ENSP00000263212	0.917	Protein phosphatase 1F
19	9606.ENSP00000346389	0.916	Myocyte-specific enhancer factor 2A
20	9606.ENSP00000361930	0.916	14-3-3 protein beta/alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004683	1.000	calmodulin-dependent protein kinase activity
GO:0005515	0.999	protein binding
GO:0042802	0.902	identical protein binding
GO:0044325	0.712	transmembrane transporter binding
GO:0042803	0.571	protein homodimerization activity
GO:0005516	0.418	calmodulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.985	regulation of biological process
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.972	primary metabolic process
GO:0044237	0.971	cellular metabolic process
GO:1901564	0.966	organonitrogen compound metabolic process
GO:0050794	0.965	regulation of cellular process
GO:0043170	0.962	macromolecule metabolic process
GO:0046777	0.952	protein autophosphorylation
GO:0050896	0.935	response to stimulus
GO:0051716	0.802	cellular response to stimulus
GO:0007154	0.668	cell communication
GO:0023052	0.661	signaling
GO:0007165	0.605	signal transduction
GO:0048518	0.585	positive regulation of biological process
GO:0019222	0.446	regulation of metabolic process
GO:0032501	0.442	multicellular organismal process
GO:0048522	0.432	positive regulation of cellular process
GO:0060255	0.430	regulation of macromolecule metabolic process
GO:0080090	0.410	regulation of primary metabolic process
GO:0051171	0.408	regulation of nitrogen compound metabolic process
GO:0048583	0.399	regulation of response to stimulus
GO:0010646	0.395	regulation of cell communication
GO:0042221	0.384	response to chemical
GO:0032502	0.382	developmental process
GO:0048519	0.373	negative regulation of biological process
GO:0048523	0.362	negative regulation of cellular process
GO:0031323	0.356	regulation of cellular metabolic process
GO:0048856	0.333	anatomical structure development
GO:0009893	0.311	positive regulation of metabolic process
GO:0010468	0.306	regulation of gene expression
GO:0023051	0.303	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005829	0.998	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005654	0.987	nucleoplasm
GO:0030054	0.986	cell junction
GO:0005886	0.974	plasma membrane
GO:0032991	0.968	protein-containing complex
GO:0031982	0.850	vesicle
GO:0031090	0.797	organelle membrane
GO:0098588	0.725	bounding membrane of organelle
GO:0031410	0.718	cytoplasmic vesicle
GO:0045202	0.715	synapse
GO:0098794	0.620	postsynapse
GO:0043232	0.538	intracellular non-membrane-bounded organelle
GO:0030139	0.464	endocytic vesicle
GO:0120025	0.457	plasma membrane bounded cell projection
GO:0030666	0.453	endocytic vesicle membrane
GO:0030425	0.446	dendrite
GO:0140535	0.378	intracellular protein-containing complex
GO:0044297	0.373	cell body
GO:0098984	0.366	neuron to neuron synapse
GO:1902494	0.358	catalytic complex
GO:0032279	0.354	asymmetric synapse
GO:0043025	0.336	neuronal cell body
GO:0014069	0.335	postsynaptic density

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.17	1.000	calcium/calmodulin-dependent protein kinase.

[back to server]