StarFunc result for job id Q13562

User Input

>input (356 residues)
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEEDSLRNGGEEE
DEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPT
TNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVF
HVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
MHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60867	0.539	0.538	2.209E-45	357	0.978	0.975	Q60867.pdb.gz	NDF1_MOUSE Neurogenic differentiation factor 1 OS=Mus musculus OX=10090 GN=Neurod1 PE=1 SV=2
2	AFDB:O42202	0.444	0.451	9.545E-38	350	0.753	0.766	O42202.pdb.gz	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
3	AFDB:P79765	0.420	0.419	6.549E-37	357	0.784	0.782	P79765.pdb.gz	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
4	AFDB:Q91616	0.542	0.548	1.219E-36	352	0.775	0.784	Q91616.pdb.gz	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
5	AFDB:Q62414	0.365	0.341	1.316E-24	383	0.511	0.475	Q62414.pdb.gz	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
6	AFDB:Q9HD90	0.332	0.354	1.795E-24	331	0.514	0.553	Q9HD90.pdb.gz	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
7	AFDB:F1QWM8	0.361	0.369	4.505E-21	348	0.475	0.486	F1QWM8.pdb.gz	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1
8	AFDB:Q6NYU3	0.405	0.432	5.428E-21	327	0.419	0.456	Q6NYU3.pdb.gz	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
9	AFDB:O16867	0.243	0.221	3.524E-6	398	0.213	0.191	O16867.pdb.gz	TAP_DROME Basic helix-loop-helix neural transcription factor TAP OS=Drosophila melanogaster OX=7227 GN=tap PE=1 SV=2
10	AFDB:P41894	0.181	0.170	6.507E-4	384	0.191	0.177	P41894.pdb.gz	DEI_DROME Helix-loop-helix protein delilah OS=Drosophila melanogaster OX=7227 GN=tx PE=1 SV=3
11	PDB:6mzcK	0.105	0.173	8.432E-1	202	0.065	0.114	6mzcK.pdb.gz
12	PDB:3j9xA	0.123	0.288	2.278	128	0.025	0.070	3j9xA.pdb.gz	A virus that infects a hyperthermophile encapsidates A-form DNA.
13	PDB:7n3mAAA	0.074	0.064	2.424	437	0.028	0.023	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.
14	PDB:7edxH	0.105	0.154	3.108	209	0.081	0.139	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:7sc9AR	0.084	0.146	3.108	160	0.045	0.100	7sc9AR.pdb.gz	Structures of a phycobilisome in light-harvesting and photoprotected states.
16	PDB:7mq8LJ	0.086	0.071	3.307	469	0.053	0.041	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:1a0pA	0.104	0.129	3.745	271	0.011	0.015	1a0pA.pdb.gz
18	PDB:6eu0Z	0.136	0.141	3.745	339	0.037	0.038	6eu0Z.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
19	PDB:3l9wB	0.096	0.096	3.985	357	0.028	0.028	3l9wB.pdb.gz	Mechanism of ligand-gated potassium efflux in bacterial pathogens.
20	PDB:6iczJ	0.102	0.072	3.985	571	0.065	0.040	6iczJ.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13562	0.0	739	356	1.000	1.000	NDF1_HUMAN Neurogenic differentiation factor 1 OS=Homo sapiens OX=9606 GN=NEUROD1 PE=1 SV=3
2	Q60867	0.0	718	357	0.978	0.975	NDF1_MOUSE Neurogenic differentiation factor 1 OS=Mus musculus OX=10090 GN=Neurod1 PE=1 SV=2
3	Q64289	0.0	719	357	0.980	0.978	NDF1_RAT Neurogenic differentiation factor 1 OS=Rattus norvegicus OX=10116 GN=Neurod1 PE=1 SV=1
4	O42202	1.87e-176	495	350	0.756	0.769	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
5	Q91616	2.15e-171	483	352	0.772	0.781	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
6	P79765	3.44e-166	469	357	0.781	0.779	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
7	Q9HD90	2.64e-102	306	331	0.517	0.556	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
8	D4A7M5	7.32e-99	297	330	0.506	0.545	D4A7M5_RAT Neurogenic differentiation factor OS=Rattus norvegicus OX=10116 GN=Neurod4 PE=4 SV=1
9	O09105	9.43e-97	292	330	0.433	0.467	NDF4_MOUSE Neurogenic differentiation factor 4 OS=Mus musculus OX=10090 GN=Neurod4 PE=1 SV=1
10	Q15784	1.81e-94	288	382	0.435	0.406	NDF2_HUMAN Neurogenic differentiation factor 2 OS=Homo sapiens OX=9606 GN=NEUROD2 PE=1 SV=2
11	Q62414	1.99e-94	288	383	0.435	0.405	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
12	P48986	5.00e-94	285	337	0.435	0.460	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
13	Q6NYU3	4.45e-87	267	327	0.390	0.425	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
14	F1QWM8	5.91e-85	263	348	0.508	0.520	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1
15	P79920	1.91e-84	260	315	0.463	0.524	NDF4_XENLA Neurogenic differentiation factor 4 OS=Xenopus laevis OX=8355 GN=neurod4 PE=1 SV=1
16	P46581	1.11e-31	120	192	0.160	0.297	NDF1_CAEEL Neurogenic differentiation factor 1 OS=Caenorhabditis elegans OX=6239 GN=cnd-1 PE=2 SV=1
17	O42606	8.70e-21	91.3	208	0.140	0.240	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
18	Q9H2A3	7.52e-20	90.1	272	0.132	0.173	NGN2_HUMAN Neurogenin-2 OS=Homo sapiens OX=9606 GN=NEUROG2 PE=1 SV=2
19	Q92886	1.77e-19	88.2	237	0.132	0.198	NGN1_HUMAN Neurogenin-1 OS=Homo sapiens OX=9606 GN=NEUROG1 PE=1 SV=2
20	P70447	2.39e-19	88.6	263	0.129	0.175	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15794 CCDC106	3.9	18.7	Coiled-coil domain-containing protein 106
2	PF02724 CDC45	1.9e+02	11.8	CDC45-like protein
3	PF00010 HLH	1.3e-11	55.6	Helix-loop-helix DNA-binding domain
4	PF12533 Neuro_bHLH	2.3e-44	163.0	Neuronal helix-loop-helix transcription factor
5	PF04147 Nop14	21	14.8	Nop14-like family
6	PF07767 Nop53	2.4e+02	12.4	Nop53 (60S ribosomal biogenesis)
7	PF05764 YL1	20	16.7	YL1 nuclear protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295108

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223366	0.966	Glucokinase
2	9606.ENSP00000262965	0.963	Transcription factor E2-alpha
3	9606.ENSP00000381382	0.930	Transcription factor 4
4	9606.ENSP00000242462	0.924	Neurogenin-3
5	9606.ENSP00000388940	0.898	Transcription factor 12
6	9606.ENSP00000404100	0.897	Paired box protein Pax-6
7	9606.ENSP00000263253	0.889	Histone acetyltransferase p300
8	9606.ENSP00000230658	0.871	Insulin gene enhancer protein ISL-1
9	9606.ENSP00000323588	0.849	Transcription factor SOX-2
10	9606.ENSP00000366347	0.848	Homeobox protein Nkx-2.2
11	9606.ENSP00000339906	0.841	Paired box protein Pax-4
12	9606.ENSP00000370421	0.835	Pancreas/duodenum homeobox protein 1
13	9606.ENSP00000295886	0.829	Homeobox protein Nkx-6.1
14	9606.ENSP00000396103	0.815	Myelin transcription factor 1-like protein
15	9606.ENSP00000357581	0.809	Homeobox protein Nkx-6.2
16	9606.ENSP00000352162	0.782	ELAV-like protein 3
17	9606.ENSP00000360811	0.764	LIM/homeobox protein Lhx3
18	9606.ENSP00000369270	0.755	Ras-responsive element-binding protein 1
19	9606.ENSP00000332208	0.754	DNA-binding protein RFX6
20	9606.ENSP00000328364	0.749	Transcription factor MafA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	0.997	DNA-binding transcription factor activity
GO:0000977	0.996	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.995	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.992	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.988	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.970	DNA-binding transcription activator activity
GO:0001228	0.952	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0070888	0.904	E-box binding
GO:0046982	0.891	protein heterodimerization activity
GO:0003682	0.803	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0032501	0.985	multicellular organismal process
GO:0009987	0.985	cellular process
GO:0051254	0.984	positive regulation of RNA metabolic process
GO:0048856	0.982	anatomical structure development
GO:0009891	0.957	positive regulation of biosynthetic process
GO:0010468	0.946	regulation of gene expression
GO:0007275	0.941	multicellular organism development
GO:0050896	0.936	response to stimulus
GO:0006355	0.936	regulation of DNA-templated transcription
GO:0006357	0.922	regulation of transcription by RNA polymerase II
GO:0048731	0.915	system development
GO:0031328	0.883	positive regulation of cellular biosynthetic process
GO:0007399	0.849	nervous system development
GO:0048513	0.847	animal organ development
GO:0045893	0.818	positive regulation of DNA-templated transcription
GO:0045944	0.674	positive regulation of transcription by RNA polymerase II
GO:0051716	0.621	cellular response to stimulus
GO:0030154	0.538	cell differentiation
GO:0048519	0.465	negative regulation of biological process
GO:0048523	0.456	negative regulation of cellular process
GO:0050793	0.424	regulation of developmental process
GO:0007154	0.416	cell communication
GO:0023052	0.387	signaling
GO:0007417	0.321	central nervous system development
GO:0007165	0.304	signal transduction
GO:0023051	0.301	regulation of signaling
GO:0010646	0.301	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.977	intracellular organelle lumen
GO:0005737	0.953	cytoplasm
GO:0031981	0.782	nuclear lumen
GO:0005654	0.677	nucleoplasm
GO:0032991	0.442	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]