StarFunc result for job id Q13563

User Input

>input (968 residues)
MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIR
QAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRP
GSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL
EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYG
MMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQ
TEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTR
ATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIF
CFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLE
DQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGF
AIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIY
FTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKN
TVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRD
DLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQ
VLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEI
HREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGG
NGSSNVHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A5F1	0.647	0.649	0.000	966	0.905	0.907	D4A5F1.pdb.gz	D4A5F1_RAT Polycystin 2, transient receptor potential cation channel OS=Rattus norvegicus OX=10116 GN=Pkd2 PE=1 SV=1
2	AFDB:F2VYA1	0.635	0.634	0.000	970	0.936	0.934	F2VYA1.pdb.gz	F2VYA1_PIG Polycystin 2, transient receptor potential cation channel OS=Sus scrofa OX=9823 GN=PKD2 PE=2 SV=1
3	AFDB:A2A259	0.554	0.702	1.641E-76	760	0.394	0.501	A2A259.pdb.gz	PK2L1_MOUSE Polycystin-2-like protein 1 OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1
4	AFDB:Q9P0L9	0.552	0.659	6.572E-75	805	0.400	0.481	Q9P0L9.pdb.gz	PK2L1_HUMAN Polycystin-2-like protein 1 OS=Homo sapiens OX=9606 GN=PKD2L1 PE=1 SV=1
5	AFDB:F1R6X2	0.547	0.666	7.717E-72	790	0.394	0.482	F1R6X2.pdb.gz
6	PDB:5mkfA	0.486	0.966	6.520E-61	481	0.495	0.996	5mkfA.pdb.gz	Molecular insights into lipid-assisted Ca(2+) regulation of the TRP channel Polycystin-2.
7	PDB:6du8A	0.419	0.945	1.339E-43	421	0.269	0.618	6du8A.pdb.gz
8	AFDB:Q8T8Z2	0.467	0.603	5.729E-30	736	0.132	0.174	Q8T8Z2.pdb.gz	Q8T8Z2_DROME AT14535p OS=Drosophila melanogaster OX=7227 GN=brv2 PE=2 SV=1
9	AFDB:X2JI61	0.459	0.582	2.331E-29	750	0.128	0.165	X2JI61.pdb.gz	X2JI61_DROME Brivido-3, isoform C OS=Drosophila melanogaster OX=7227 GN=brv3 PE=3 SV=1
10	AFDB:Q9VVZ8	0.449	0.585	5.003E-28	728	0.130	0.173	Q9VVZ8.pdb.gz	Q9VVZ8_DROME Brivido-1 OS=Drosophila melanogaster OX=7227 GN=brv1 PE=2 SV=1
11	AFDB:Q2EG98	0.445	0.203	6.159E-28	2201	0.130	0.057	Q2EG98.pdb.gz	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
12	AFDB:Q9Z0T6	0.458	0.216	5.465E-27	2126	0.140	0.064	Q9Z0T6.pdb.gz	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
13	PDB:5w3sA	0.293	0.518	1.533E-12	485	0.068	0.136	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
14	PDB:5wj9A	0.282	0.505	9.957E-12	479	0.071	0.144	5wj9A.pdb.gz	Human TRPML1 channel structures in open and closed conformations.
15	PDB:7dysA	0.274	0.597	1.858E-11	387	0.061	0.152	7dysA.pdb.gz
16	PDB:6aygA	0.284	0.560	4.355E-9	439	0.071	0.157	6aygA.pdb.gz
17	PDB:7b0jA	0.186	0.258	1.837E-7	682	0.043	0.062	7b0jA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
18	PDB:5ye5A	0.285	0.517	3.611E-7	464	0.062	0.129	5ye5A.pdb.gz
19	PDB:6pqpA	0.202	0.311	3.611E-7	615	0.065	0.102	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:7dxbA	0.196	0.252	1.021E-6	738	0.063	0.083	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A259	0.0	754	760	0.387	0.493	PK2L1_MOUSE Polycystin-2-like protein 1 OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1
2	B4DFN3	0.0	786	386	0.399	1.000	B4DFN3_HUMAN Polycystin 2, transient receptor potential cation channel OS=Homo sapiens OX=9606 GN=PKD2 PE=1 SV=1
3	D4A5F1	0.0	1565	966	0.872	0.874	D4A5F1_RAT Polycystin 2, transient receptor potential cation channel OS=Rattus norvegicus OX=10116 GN=Pkd2 PE=1 SV=1
4	F2VYA1	0.0	1595	970	0.927	0.925	F2VYA1_PIG Polycystin 2, transient receptor potential cation channel OS=Sus scrofa OX=9823 GN=PKD2 PE=2 SV=1
5	H2LRU7	0.0	1111	901	0.611	0.656	PKD2_ORYLA Polycystin-2 OS=Oryzias latipes OX=8090 GN=pkd2 PE=1 SV=2
6	O35245	0.0	1596	966	0.890	0.892	PKD2_MOUSE Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1 SV=2
7	Q13563	0.0	2002	968	1.000	1.000	PKD2_HUMAN Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 SV=3
8	Q6IVV8	0.0	1120	904	0.605	0.648	PKD2_DANRE Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1
9	Q9P0L9	0.0	754	805	0.396	0.476	PK2L1_HUMAN Polycystin-2-like protein 1 OS=Homo sapiens OX=9606 GN=PKD2L1 PE=1 SV=1
10	Q9NZM6	3.60e-176	528	624	0.302	0.468	PK2L2_HUMAN Polycystin-2-like protein 2 OS=Homo sapiens OX=9606 GN=PKD2L2 PE=2 SV=2
11	Q9U1S7	6.93e-124	395	716	0.252	0.341	PKD2_CAEEL Polycystin-2 OS=Caenorhabditis elegans OX=6239 GN=pkd-2 PE=1 SV=3
12	Q9VK95	1.31e-94	322	924	0.163	0.171	Q9VK95_DROME MIP30126p OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=2
13	Q6T3S5	5.61e-94	320	924	0.162	0.170	Q6T3S5_DROME AMO OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=1
14	Q2EG98	4.62e-41	167	2201	0.134	0.059	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
15	Q09624	1.22e-37	156	3284	0.135	0.040	PKD1_CAEEL Location of vulva defective 1 OS=Caenorhabditis elegans OX=6239 GN=lov-1 PE=1 SV=4
16	Q558Y3	4.09e-37	152	698	0.124	0.172	Q558Y3_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272999 PE=3 SV=1
17	P98161	1.31e-26	120	4303	0.106	0.024	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
18	Q9NTG1	4.80e-26	118	2253	0.116	0.050	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
19	Q9ERV0	1.97e-25	117	4283	0.111	0.025	Q9ERV0_RAT Pkd1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
20	F1MAD3	5.28e-25	115	4292	0.110	0.025	F1MAD3_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	0.56	20.9	EF hand
2	PF13405 EF-hand_6	82	14.5	EF-hand domain
3	PF13833 EF-hand_8	1.4e+02	13.7	EF-hand domain pair
4	PF18109 Fer4_24	0.0032	28.9	Ferredoxin I 4Fe-4S cluster domain
5	PF00520 Ion_trans	5.7e-21	86.4	Ion transport protein
6	PF08016 PKD_channel	1.5e-81	284.6	Polycystin cation channel
7	PF20519 Polycystin_dom	1.4e-65	232.1	Polycystin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262304	0.994	Polycystin-1
2	9606.ENSP00000419313	0.994	Short transient receptor potential channel 1
3	9606.ENSP00000406191	0.991	Transient receptor potential cation channel subfamily V member 4
4	9606.ENSP00000360158	0.981	Fibrocystin
5	9606.ENSP00000306253	0.970	Inositol 1,4,5-trisphosphate receptor type 1
6	9606.ENSP00000234091	0.967	DNA-binding protein inhibitor ID-2
7	9606.ENSP00000329002	0.945	HCLS1-associated protein X-1
8	9606.ENSP00000316454	0.934	Phosphofurin acidic cluster sorting protein 1
9	9606.ENSP00000484855	0.929	Exocyst complex component 5
10	9606.ENSP00000355533	0.913	Ryanodine receptor 2
11	9606.ENSP00000306010	0.884	ADP-ribosylation factor 4
12	9606.ENSP00000385808	0.853	Kinesin-like protein KIF3A
13	9606.ENSP00000300935	0.852	Ras-related protein Rab-8A
14	9606.ENSP00000478962	0.839	Protein chibby homolog 1
15	9606.ENSP00000464443	0.836	Intraflagellar transport protein 20 homolog
16	9606.ENSP00000419465	0.826	WW domain-containing transcription regulator protein 1
17	9606.ENSP00000393559	0.824	Phosphofurin acidic cluster sorting protein 2
18	9606.ENSP00000268766	0.799	Serine/threonine-protein kinase Nek8
19	9606.ENSP00000323580	0.785	Intraflagellar transport protein 88 homolog
20	9606.ENSP00000447300	0.778	Rab-3A-interacting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005262	0.999	calcium channel activity
GO:0042802	0.997	identical protein binding
GO:0022839	0.997	monoatomic ion gated channel activity
GO:0051393	0.996	alpha-actinin binding
GO:0043167	0.993	ion binding
GO:0051371	0.975	muscle alpha-actinin binding
GO:0005509	0.959	calcium ion binding
GO:0015079	0.895	potassium ion transmembrane transporter activity
GO:0005267	0.888	potassium channel activity
GO:0005272	0.806	sodium channel activity
GO:0022832	0.606	voltage-gated channel activity
GO:0005244	0.592	voltage-gated monoatomic ion channel activity
GO:0022843	0.576	voltage-gated monoatomic cation channel activity
GO:0005249	0.347	voltage-gated potassium channel activity
GO:0019904	0.304	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0030001	0.985	metal ion transport
GO:0098655	0.985	monoatomic cation transmembrane transport
GO:0098662	0.984	inorganic cation transmembrane transport
GO:0050794	0.982	regulation of cellular process
GO:0006816	0.980	calcium ion transport
GO:0070588	0.968	calcium ion transmembrane transport
GO:0032879	0.963	regulation of localization
GO:0050896	0.958	response to stimulus
GO:0043269	0.948	regulation of monoatomic ion transport
GO:0007154	0.932	cell communication
GO:0051716	0.926	cellular response to stimulus
GO:0048522	0.925	positive regulation of cellular process
GO:0010959	0.922	regulation of metal ion transport
GO:0071840	0.920	cellular component organization or biogenesis
GO:0023052	0.919	signaling
GO:0016043	0.900	cellular component organization
GO:0097553	0.895	calcium ion transmembrane import into cytosol
GO:0051282	0.891	regulation of sequestering of calcium ion
GO:0032501	0.884	multicellular organismal process
GO:1903169	0.877	regulation of calcium ion transmembrane transport
GO:0048856	0.876	anatomical structure development
GO:0006950	0.864	response to stress
GO:0044085	0.863	cellular component biogenesis
GO:0022898	0.838	regulation of transmembrane transporter activity
GO:0022607	0.832	cellular component assembly
GO:0032412	0.829	regulation of monoatomic ion transmembrane transporter activity
GO:0048519	0.827	negative regulation of biological process
GO:0051283	0.815	negative regulation of sequestering of calcium ion
GO:0051209	0.811	release of sequestered calcium ion into cytosol
GO:1901019	0.801	regulation of calcium ion transmembrane transporter activity
GO:0042221	0.792	response to chemical
GO:1904064	0.778	positive regulation of cation transmembrane transport
GO:0032414	0.776	positive regulation of ion transmembrane transporter activity
GO:0007275	0.768	multicellular organism development
GO:0007165	0.768	signal transduction
GO:1904427	0.766	positive regulation of calcium ion transmembrane transport
GO:1901021	0.760	positive regulation of calcium ion transmembrane transporter activity
GO:0071495	0.754	cellular response to endogenous stimulus
GO:2001257	0.734	regulation of cation channel activity
GO:0010033	0.726	response to organic substance
GO:0071805	0.704	potassium ion transmembrane transport
GO:0019222	0.698	regulation of metabolic process
GO:0010243	0.696	response to organonitrogen compound
GO:1901699	0.696	cellular response to nitrogen compound
GO:0071417	0.679	cellular response to organonitrogen compound
GO:0007204	0.660	positive regulation of cytosolic calcium ion concentration
GO:0051262	0.643	protein tetramerization
GO:0048731	0.637	system development
GO:1901700	0.631	response to oxygen-containing compound
GO:0048513	0.623	animal organ development
GO:0009653	0.586	anatomical structure morphogenesis
GO:0035239	0.583	tube morphogenesis
GO:0009888	0.582	tissue development
GO:0009628	0.565	response to abiotic stimulus
GO:1901701	0.549	cellular response to oxygen-containing compound
GO:0051260	0.538	protein homooligomerization
GO:0060429	0.518	epithelium development
GO:0035725	0.485	sodium ion transmembrane transport
GO:1902074	0.467	response to salt
GO:0006996	0.453	organelle organization
GO:0061326	0.442	renal tubule development
GO:0060562	0.431	epithelial tube morphogenesis
GO:0001822	0.422	kidney development
GO:0010035	0.420	response to inorganic substance
GO:1902075	0.381	cellular response to salt
GO:0003002	0.366	regionalization
GO:0014074	0.336	response to purine-containing compound
GO:0007368	0.321	determination of left/right symmetry
GO:0046683	0.320	response to organophosphorus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005737	0.997	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0042995	0.994	cell projection
GO:0012505	0.994	endomembrane system
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005886	0.985	plasma membrane
GO:0032991	0.982	protein-containing complex
GO:0005783	0.982	endoplasmic reticulum
GO:0005856	0.979	cytoskeleton
GO:0005929	0.956	cilium
GO:0005829	0.928	cytosol
GO:0031090	0.757	organelle membrane
GO:0005815	0.686	microtubule organizing center
GO:0098590	0.553	plasma membrane region
GO:0005813	0.535	centrosome
GO:0031982	0.422	vesicle
GO:0072686	0.399	mitotic spindle
GO:0098588	0.317	bounding membrane of organelle
GO:0005576	0.306	extracellular region
GO:0099512	0.300	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.999	Ca(2+)(in) = Ca(2+)(out)
RHEA:29463	0.895	K(+)(in) = K(+)(out)
RHEA:34963	0.806	Na(+)(in) = Na(+)(out)

[back to server]