StarFunc result for job id Q13568

User Input

>input (498 residues)
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGD
NTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEV
CSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQ
PPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLI
SPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP
SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP
IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPG
AGLGVGQGPWPMHPAGMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13568	1.000	1.000	1.064E-94	498	1.000	1.000	Q13568.pdb.gz	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
2	AFDB:A0A0G2JUR2	0.486	0.508	2.628E-77	475	0.805	0.844	A0A0G2JUR2.pdb.gz	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
3	AFDB:G0Z349	0.392	0.417	1.960E-55	467	0.482	0.514	G0Z349.pdb.gz	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
4	AFDB:Q6PGZ7	0.384	0.389	1.187E-50	492	0.498	0.504	Q6PGZ7.pdb.gz	Q6PGZ7_DANRE Interferon regulatory factor 6 OS=Danio rerio OX=7955 GN=zgc:63500 PE=1 SV=1
5	AFDB:Q15306	0.345	0.379	4.660E-33	451	0.293	0.324	Q15306.pdb.gz	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
6	AFDB:A8B8L1	0.343	0.370	4.734E-32	460	0.279	0.302	A8B8L1.pdb.gz
7	AFDB:Q6DHK7	0.360	0.420	5.316E-32	423	0.259	0.305	Q6DHK7.pdb.gz	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
8	AFDB:Q92985	0.359	0.355	5.485E-30	503	0.259	0.256	Q92985.pdb.gz	IRF7_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=2
9	AFDB:B5X2E7	0.342	0.405	2.336E-29	415	0.271	0.325	B5X2E7.pdb.gz	B5X2E7_SALSA Interferon regulatory factor 7 OS=Salmo salar OX=8030 GN=IRF7 PE=2 SV=1
10	AFDB:M9RSF4	0.335	0.343	2.336E-29	487	0.269	0.275	M9RSF4.pdb.gz	M9RSF4_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=1
11	PDB:7dvqX	0.160	0.454	9.289E-2	156	0.036	0.115	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:2kb3A	0.103	0.308	3.523E-1	143	0.024	0.084	2kb3A.pdb.gz
13	PDB:5fm7B	0.059	0.067	6.664E-1	422	0.024	0.028	5fm7B.pdb.gz	The Combination of X-Ray Crystallography and Cryo-Electron Microscopy Provides Insight Into the Overall Architecture of the Dodecameric Rvb1/Rvb2 Complex.
14	PDB:2z9sA	0.077	0.135	7.484E-1	197	0.052	0.132	2z9sA.pdb.gz
15	PDB:3wvzA	0.063	0.113	8.905E-1	192	0.054	0.141	3wvzA.pdb.gz
16	PDB:7odrO	0.078	0.195	1.123	154	0.038	0.123	7odrO.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
17	PDB:7kgbN	0.076	0.252	1.416	116	0.034	0.147	7kgbN.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
18	PDB:7kzpB	0.051	0.045	1.685	701	0.054	0.039	7kzpB.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
19	PDB:3dwlD	0.056	0.088	1.785	272	0.032	0.059	3dwlD.pdb.gz	Structure and biochemical properties of fission yeast arp2/3 complex lacking the arp2 subunit.
20	PDB:3j6bP	0.051	0.105	1.785	207	0.054	0.130	3j6bP.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUR2	0.0	818	528	0.878	0.828	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
2	A0A8I5YBA0	0.0	820	536	0.878	0.815	A0A8I5YBA0_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
3	D3ZPU1	0.0	819	497	0.880	0.881	D3ZPU1_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
4	P56477	0.0	818	497	0.869	0.871	IRF5_MOUSE Interferon regulatory factor 5 OS=Mus musculus OX=10090 GN=Irf5 PE=1 SV=1
5	Q13568	0.0	1009	498	1.000	1.000	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
6	P97431	1.25e-92	291	467	0.293	0.313	IRF6_MOUSE Interferon regulatory factor 6 OS=Mus musculus OX=10090 GN=Irf6 PE=1 SV=2
7	G0Z349	4.29e-91	287	467	0.289	0.308	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
8	O14896	4.29e-91	287	467	0.289	0.308	IRF6_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=1 SV=1
9	Q15306	7.09e-58	200	451	0.301	0.333	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
10	Q02556	4.78e-57	197	426	0.293	0.343	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
11	P23611	6.71e-57	197	424	0.293	0.344	IRF8_MOUSE Interferon regulatory factor 8 OS=Mus musculus OX=10090 GN=Irf8 PE=1 SV=1
12	Q64287	7.18e-57	197	450	0.283	0.313	IRF4_MOUSE Interferon regulatory factor 4 OS=Mus musculus OX=10090 GN=Irf4 PE=1 SV=1
13	Q6DHK7	1.96e-56	195	423	0.281	0.331	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
14	A0A8I6AJP7	7.07e-56	195	466	0.287	0.307	A0A8I6AJP7_RAT Interferon regulatory factor 8 OS=Rattus norvegicus OX=10116 GN=Irf8 PE=4 SV=1
15	B1AJU4	5.31e-48	169	276	0.155	0.279	B1AJU4_HUMAN Interferon regulatory factor 6 (Fragment) OS=Homo sapiens OX=9606 GN=IRF6 PE=1 SV=1
16	Q764M6	9.07e-47	169	419	0.287	0.341	IRF3_PIG Interferon regulatory factor 3 OS=Sus scrofa OX=9823 GN=IRF3 PE=1 SV=1
17	Q14653	1.91e-46	169	427	0.287	0.335	IRF3_HUMAN Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
18	Q6PGZ7	2.80e-46	170	492	0.155	0.157	Q6PGZ7_DANRE Interferon regulatory factor 6 OS=Danio rerio OX=7955 GN=zgc:63500 PE=1 SV=1
19	H3BT31	4.21e-46	165	328	0.251	0.381	H3BT31_HUMAN Interferon regulatory factor 8 (Fragment) OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=1
20	Q5XIB0	4.82e-44	162	421	0.283	0.335	Q5XIB0_RAT Interferon regulatory factor 3 OS=Rattus norvegicus OX=10116 GN=Irf3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00605 IRF	5.8e-36	134.3	Interferon regulatory factor transcription factor
2	PF10401 IRF-3	4.8e-69	243.2	Interferon-regulatory factor 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.994	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000384273	0.991	Transcription factor p65
3	9606.ENSP00000433623	0.977	TNF receptor-associated factor 6
4	9606.ENSP00000262367	0.976	CREB-binding protein
5	9606.ENSP00000354394	0.969	Signal transducer and activator of transcription 1-alpha/beta
6	9606.ENSP00000369581	0.966	Interferon beta
7	9606.ENSP00000471896	0.962	Interferon regulatory factor 3
8	9606.ENSP00000358997	0.961	Interleukin-1 receptor-associated kinase 1
9	9606.ENSP00000315768	0.956	Signal transducer and activator of transcription 2
10	9606.ENSP00000368699	0.952	Ubiquitin-like protein ISG15
11	9606.ENSP00000345347	0.949	High mobility group protein B1
12	9606.ENSP00000381601	0.948	Interferon-induced GTP-binding protein Mx1
13	9606.ENSP00000388001	0.946	2'-5'-oligoadenylate synthase 1
14	9606.ENSP00000360869	0.945	Interferon-induced protein with tetratricopeptide repeats 1
15	9606.ENSP00000371471	0.940	Radical S-adenosyl methionine domain-containing protein 2
16	9606.ENSP00000380697	0.936	Interferon regulatory factor 7
17	9606.ENSP00000257570	0.934	2'-5'-oligoadenylate synthase-like protein
18	9606.ENSP00000306565	0.933	Interferon-stimulated gene 20 kDa protein
19	9606.ENSP00000360266	0.933	Transcription factor AP-1
20	9606.ENSP00000360891	0.932	Interferon-induced protein with tetratricopeptide repeats 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0019901	1.000	protein kinase binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0042802	0.998	identical protein binding
GO:0001216	0.998	DNA-binding transcription activator activity
GO:0001228	0.990	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000976	0.579	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.999	cellular process
GO:0010468	0.997	regulation of gene expression
GO:0080090	0.995	regulation of primary metabolic process
GO:0048522	0.995	positive regulation of cellular process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0051716	0.994	cellular response to stimulus
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0007154	0.979	cell communication
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0009605	0.955	response to external stimulus
GO:0044419	0.950	biological process involved in interspecies interaction between organisms
GO:0009607	0.950	response to biotic stimulus
GO:0042221	0.947	response to chemical
GO:0023052	0.946	signaling
GO:0051173	0.937	positive regulation of nitrogen compound metabolic process
GO:0007165	0.933	signal transduction
GO:0031325	0.931	positive regulation of cellular metabolic process
GO:0010033	0.927	response to organic substance
GO:0051707	0.924	response to other organism
GO:0034097	0.916	response to cytokine
GO:0045893	0.903	positive regulation of DNA-templated transcription
GO:0051239	0.899	regulation of multicellular organismal process
GO:0071345	0.898	cellular response to cytokine stimulus
GO:0045944	0.893	positive regulation of transcription by RNA polymerase II
GO:0007166	0.881	cell surface receptor signaling pathway
GO:0001817	0.868	regulation of cytokine production
GO:0051240	0.851	positive regulation of multicellular organismal process
GO:0019221	0.842	cytokine-mediated signaling pathway
GO:0006950	0.779	response to stress
GO:0010628	0.765	positive regulation of gene expression
GO:0002376	0.758	immune system process
GO:0001819	0.722	positive regulation of cytokine production
GO:0048519	0.607	negative regulation of biological process
GO:0006952	0.560	defense response
GO:0006955	0.544	immune response
GO:0098542	0.527	defense response to other organism
GO:0048583	0.490	regulation of response to stimulus
GO:0009615	0.449	response to virus
GO:0048523	0.408	negative regulation of cellular process
GO:0032479	0.353	regulation of type I interferon production
GO:0045087	0.341	innate immune response
GO:0002682	0.337	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.982	cytosol
GO:0016020	0.371	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]