StarFunc result for job id Q13569

User Input

>input (410 residues)
MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKG
RKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELL
TKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHT
LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK
EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK
GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSS
NGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13569	1.000	1.000	1.622E-77	410	1.000	1.000	Q13569.pdb.gz	TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase OS=Homo sapiens OX=9606 GN=TDG PE=1 SV=2
2	AFDB:P56581	0.798	0.778	1.905E-67	421	0.883	0.860	P56581.pdb.gz	TDG_MOUSE G/T mismatch-specific thymine DNA glycosylase OS=Mus musculus OX=10090 GN=Tdg PE=1 SV=2
3	AFDB:Q9PUA4	0.598	0.601	1.995E-61	408	0.766	0.770	Q9PUA4.pdb.gz	Q9PUA4_CHICK G/T mismatch DNA glycosylase OS=Gallus gallus OX=9031 GN=5-MCDG PE=2 SV=1
4	AFDB:O59825	0.444	0.553	4.039E-21	325	0.188	0.237	O59825.pdb.gz	TDG_SCHPO G/U mismatch-specific uracil DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thp1 PE=3 SV=1
5	PDB:1mwiA	0.384	0.929	3.640E-17	165	0.129	0.321	1mwiA.pdb.gz	Crystal structure of a G:T/U mismatch-specific DNA glycosylase: mismatch recognition by complementary-strand interactions.
6	PDB:2d3yA	0.343	0.599	3.538E-7	219	0.088	0.164	2d3yA.pdb.gz	Crystal structure of family 5 uracil-DNA glycosylase bound to DNA.
7	PDB:1l9gA	0.328	0.636	1.329E-6	191	0.073	0.157	1l9gA.pdb.gz	Characterization of the full length uracil-DNA glycosylase in the extreme thermophile Thermotoga Maritima
8	PDB:1ui0A	0.334	0.649	9.368E-6	192	0.066	0.141	1ui0A.pdb.gz	Crystal Structure of a Family 4 Uracil-DNA Glycosylase from Thermus thermophilus HB8
9	PDB:2l3fA	0.290	0.653	1.321E-4	161	0.085	0.217	2l3fA.pdb.gz
10	AFDB:Q08682	0.189	0.239	2.044E-3	298	0.076	0.104	Q08682.pdb.gz	RSSA1_ARATH Small ribosomal subunit protein uS2z OS=Arabidopsis thaliana OX=3702 GN=RPSaA PE=1 SV=3
11	AFDB:A0A2R8QMT4	0.181	0.105	8.175E-3	847	0.095	0.046	A0A2R8QMT4.pdb.gz
12	AFDB:Q7KHK9	0.170	0.140	1.271E-2	527	0.117	0.091	Q7KHK9.pdb.gz	Q7KHK9_DROME DREAM OS=Drosophila melanogaster OX=7227 GN=Strica PE=1 SV=1
13	AFDB:D3KYL1	0.210	0.130	1.535E-2	736	0.090	0.050	D3KYL1.pdb.gz	D3KYL1_DANRE Gephyrin b OS=Danio rerio OX=7955 GN=gphn2 PE=1 SV=1
14	PDB:4h3hE	0.147	0.259	1.917E-2	192	0.039	0.083	4h3hE.pdb.gz	An unexpected binding mode for a Pol II CTD peptide phosphorylated at Ser7 in the active site of the CTD phosphatase Ssu72.
15	PDB:4od8B	0.261	0.441	1.917E-2	221	0.056	0.104	4od8B.pdb.gz
16	AFDB:Q9TXR6	0.168	0.077	2.240E-2	1094	0.115	0.043	Q9TXR6.pdb.gz	Q9TXR6_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=2
17	AFDB:P11938	0.084	0.050	2.706E-2	827	0.102	0.051	P11938.pdb.gz	RAP1_YEAST DNA-binding protein RAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAP1 PE=1 SV=2
18	PDB:5x55A	0.246	0.347	4.933E-2	276	0.044	0.065	5x55A.pdb.gz
19	PDB:6ks6A	0.082	0.066	5.253E-2	550	0.063	0.047	6ks6A.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
20	PDB:3a7nA	0.241	0.387	6.759E-2	233	0.063	0.112	3a7nA.pdb.gz	Structure of uracil-DNA glycosylase from Mycobacterium tuberculosis: insights into interactions with ligands

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MIY3	0.0	709	410	0.876	0.876	A0A096MIY3_RAT Thymine-DNA glycosylase OS=Rattus norvegicus OX=10116 GN=Tdg PE=1 SV=1
2	A0A096MK32	0.0	704	420	0.868	0.848	A0A096MK32_RAT Thymine-DNA glycosylase OS=Rattus norvegicus OX=10116 GN=Tdg PE=1 SV=1
3	A1L1J2	0.0	677	385	0.834	0.888	A1L1J2_RAT Thymine-DNA glycosylase OS=Rattus norvegicus OX=10116 GN=Tdg PE=2 SV=1
4	B4E127	0.0	569	267	0.651	1.000	B4E127_HUMAN Thymine DNA glycosylase OS=Homo sapiens OX=9606 GN=TDG PE=1 SV=1
5	F5H0I7	0.0	525	257	0.627	1.000	F5H0I7_HUMAN Thymine DNA glycosylase (Fragment) OS=Homo sapiens OX=9606 GN=TDG PE=1 SV=1
6	G8JL98	0.0	838	406	0.980	0.990	G8JL98_HUMAN Thymine DNA glycosylase OS=Homo sapiens OX=9606 GN=TDG PE=1 SV=1
7	P56581	0.0	721	421	0.883	0.860	TDG_MOUSE G/T mismatch-specific thymine DNA glycosylase OS=Mus musculus OX=10090 GN=Tdg PE=1 SV=2
8	Q13569	0.0	854	410	1.000	1.000	TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase OS=Homo sapiens OX=9606 GN=TDG PE=1 SV=2
9	Q99NG8	0.0	671	386	0.832	0.883	Q99NG8_RAT T:G mismatch thymine glycosylase OS=Rattus norvegicus OX=10116 GN=Tdg PE=2 SV=1
10	Q9PUA4	0.0	593	408	0.761	0.765	Q9PUA4_CHICK G/T mismatch DNA glycosylase OS=Gallus gallus OX=9031 GN=5-MCDG PE=2 SV=1
11	Q9V4D8	1.22e-74	255	1738	0.293	0.069	Q9V4D8_DROME FI14922p OS=Drosophila melanogaster OX=7227 GN=Tdg PE=1 SV=1
12	O59825	2.42e-26	110	325	0.146	0.185	TDG_SCHPO G/U mismatch-specific uracil DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thp1 PE=3 SV=1
13	P0A9H1	1.87e-18	84.3	168	0.122	0.298	MUG_ECOLI G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain K12) OX=83333 GN=mug PE=1 SV=1
14	Q46EH7	0.067	36.6	158	0.037	0.095	HDG_METBF Hypoxanthine DNA glycosylase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) OX=269797 GN=Mbar_A0737 PE=1 SV=1
15	Q8TTH3	0.19	35.0	158	0.034	0.089	HDG_METAC Hypoxanthine DNA glycosylase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=MA_0462 PE=1 SV=1
16	B0RSR5	1.4	33.9	922	0.063	0.028	B0RSR5_XANCB Aconitate hydratase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=rpfA PE=3 SV=1
17	Q8N9I5	1.9	33.1	356	0.088	0.101	FADS6_HUMAN Fatty acid desaturase 6 OS=Homo sapiens OX=9606 GN=FADS6 PE=1 SV=2
18	Q6Q1Q8	2.1	33.1	730	0.041	0.023	Q6Q1Q8_CHICK Mannan-binding lectin associated serine protease 3 OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q8JFF9	2.7	32.7	554	0.029	0.022	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
20	Q07998	3.2	32.3	423	0.032	0.031	TBXTA_DANRE T-box transcription factor T-A OS=Danio rerio OX=7955 GN=tbxta PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03167 UDG	9e-15	66.5	Uracil DNA glycosylase superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376611

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376077	0.999	Small ubiquitin-related modifier 1
2	9606.ENSP00000405965	0.997	Small ubiquitin-related modifier 2
3	9606.ENSP00000360025	0.990	Growth arrest and DNA damage-inducible protein GADD45 alpha
4	9606.ENSP00000264709	0.979	DNA (cytosine-5)-methyltransferase 3A
5	9606.ENSP00000348056	0.978	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000262367	0.971	CREB-binding protein
7	9606.ENSP00000409666	0.968	Small ubiquitin-like modifier 3
8	9606.ENSP00000216714	0.936	DNA-(apurinic or apyrimidinic site) lyase
9	9606.ENSP00000424191	0.912	Single-strand selective monofunctional uracil DNA glycosylase
10	9606.ENSP00000328547	0.910	DNA (cytosine-5)-methyltransferase 3B
11	9606.ENSP00000242576	0.907	Uracil-DNA glycosylase
12	9606.ENSP00000362748	0.904	Methylcytosine dioxygenase TET1
13	9606.ENSP00000405330	0.901	Estrogen receptor
14	9606.ENSP00000269305	0.873	Cellular tumor antigen p53
15	9606.ENSP00000249910	0.870	Methyl-CpG-binding domain protein 4
16	9606.ENSP00000337332	0.861	NAD-dependent protein deacetylase sirtuin-6
17	9606.ENSP00000386869	0.855	Methylcytosine dioxygenase TET3
18	9606.ENSP00000442788	0.852	Methylcytosine dioxygenase TET2
19	9606.ENSP00000263253	0.837	Histone acetyltransferase p300
20	9606.ENSP00000352516	0.837	DNA (cytosine-5)-methyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019104	1.000	DNA N-glycosylase activity
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0003677	0.994	DNA binding
GO:0032182	0.928	ubiquitin-like protein binding
GO:0032183	0.923	SUMO binding
GO:0004844	0.765	uracil DNA N-glycosylase activity
GO:0003690	0.490	double-stranded DNA binding
GO:0019904	0.427	protein domain specific binding
GO:0140297	0.406	DNA-binding transcription factor binding
GO:0042802	0.316	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.978	organic substance metabolic process
GO:0044238	0.977	primary metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0065007	0.975	biological regulation
GO:0050896	0.969	response to stimulus
GO:0006807	0.960	nitrogen compound metabolic process
GO:0043170	0.948	macromolecule metabolic process
GO:0050794	0.946	regulation of cellular process
GO:0051716	0.943	cellular response to stimulus
GO:0044260	0.943	cellular macromolecule metabolic process
GO:0006139	0.937	nucleobase-containing compound metabolic process
GO:0090304	0.933	nucleic acid metabolic process
GO:0006281	0.906	DNA repair
GO:0006304	0.859	DNA modification
GO:0006284	0.850	base-excision repair
GO:0019222	0.847	regulation of metabolic process
GO:0060255	0.836	regulation of macromolecule metabolic process
GO:0080090	0.820	regulation of primary metabolic process
GO:0051171	0.815	regulation of nitrogen compound metabolic process
GO:0031323	0.788	regulation of cellular metabolic process
GO:0019219	0.747	regulation of nucleobase-containing compound metabolic process
GO:1901564	0.710	organonitrogen compound metabolic process
GO:0072527	0.697	pyrimidine-containing compound metabolic process
GO:1901565	0.681	organonitrogen compound catabolic process
GO:0072529	0.673	pyrimidine-containing compound catabolic process
GO:0009219	0.673	pyrimidine deoxyribonucleotide metabolic process
GO:0010468	0.658	regulation of gene expression
GO:0034655	0.655	nucleobase-containing compound catabolic process
GO:1901136	0.648	carbohydrate derivative catabolic process
GO:0045934	0.636	negative regulation of nucleobase-containing compound metabolic process
GO:0031326	0.626	regulation of cellular biosynthetic process
GO:0010556	0.625	regulation of macromolecule biosynthetic process
GO:0010605	0.625	negative regulation of macromolecule metabolic process
GO:0009166	0.625	nucleotide catabolic process
GO:0006355	0.619	regulation of DNA-templated transcription
GO:0006357	0.541	regulation of transcription by RNA polymerase II
GO:0031327	0.526	negative regulation of cellular biosynthetic process
GO:0045892	0.509	negative regulation of DNA-templated transcription
GO:0000122	0.409	negative regulation of transcription by RNA polymerase II
GO:0065009	0.349	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.972	membrane
GO:0071944	0.961	cell periphery
GO:0005886	0.932	plasma membrane
GO:0005737	0.523	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.

[back to server]