StarFunc result for job id Q13571

User Input

>input (262 residues)
MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI
ADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAY
LKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP
HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYE
EALSLPSKTPEGGPAPPPYSEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13571	1.000	1.000	1.527E-36	262	1.000	1.000	Q13571.pdb.gz	LAPM5_HUMAN Lysosomal-associated transmembrane protein 5 OS=Homo sapiens OX=9606 GN=LAPTM5 PE=1 SV=1
2	AFDB:Q61168	0.830	0.833	8.653E-27	261	0.790	0.793	Q61168.pdb.gz	LAPM5_MOUSE Lysosomal-associated transmembrane protein 5 OS=Mus musculus OX=10090 GN=Laptm5 PE=1 SV=1
3	AFDB:A0A0G2K184	0.517	0.525	8.635E-19	257	0.725	0.739	A0A0G2K184.pdb.gz	A0A0G2K184_RAT Lysosomal protein transmembrane 5 OS=Rattus norvegicus OX=10116 GN=Laptm5 PE=3 SV=1
4	AFDB:Q15012	0.507	0.563	3.094E-7	233	0.237	0.266	Q15012.pdb.gz	LAP4A_HUMAN Lysosomal-associated transmembrane protein 4A OS=Homo sapiens OX=9606 GN=LAPTM4A PE=1 SV=1
5	AFDB:Q86VI4	0.518	0.437	1.082E-5	317	0.183	0.151	Q86VI4.pdb.gz	LAP4B_HUMAN Lysosomal-associated transmembrane protein 4B OS=Homo sapiens OX=9606 GN=LAPTM4B PE=1 SV=2
6	AFDB:O95859	0.360	0.320	6.225E-3	305	0.118	0.102	O95859.pdb.gz	TSN12_HUMAN Tetraspanin-12 OS=Homo sapiens OX=9606 GN=TSPAN12 PE=1 SV=1
7	AFDB:P19075	0.354	0.383	1.555E-2	237	0.099	0.110	P19075.pdb.gz	TSN8_HUMAN Tetraspanin-8 OS=Homo sapiens OX=9606 GN=TSPAN8 PE=1 SV=1
8	AFDB:Q9JHH2	0.289	0.294	2.148E-2	256	0.130	0.133	Q9JHH2.pdb.gz	TSN32_MOUSE Tetraspanin-32 OS=Mus musculus OX=10090 GN=Tspan32 PE=2 SV=2
9	AFDB:O60637	0.407	0.418	3.885E-2	253	0.115	0.119	O60637.pdb.gz	TSN3_HUMAN Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3 PE=2 SV=1
10	AFDB:Q96QS1	0.267	0.236	4.327E-2	320	0.126	0.103	Q96QS1.pdb.gz	TSN32_HUMAN Tetraspanin-32 OS=Homo sapiens OX=9606 GN=TSPAN32 PE=2 SV=1
11	PDB:6wvgA	0.378	0.242	2.639E-1	443	0.095	0.056	6wvgA.pdb.gz
12	PDB:7bylA	0.137	0.108	3.274E-1	354	0.176	0.130	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
13	PDB:6k4jA	0.227	0.254	3.455E-1	220	0.095	0.114	6k4jA.pdb.gz
14	PDB:6wvdA	0.256	0.181	3.646E-1	397	0.103	0.068	6wvdA.pdb.gz
15	PDB:7yziA	0.234	0.176	4.285E-1	378	0.088	0.061	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
16	PDB:7oqzA	0.165	0.162	6.248E-1	237	0.126	0.139	7oqzA.pdb.gz
17	PDB:3hajA	0.227	0.211	1.192	286	0.115	0.105	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:6wv9A	0.195	0.133	1.192	411	0.095	0.061	6wv9A.pdb.gz
19	PDB:5sv0A	0.157	0.171	1.258	233	0.115	0.129	5sv0A.pdb.gz
20	PDB:5w3sA	0.157	0.105	1.401	485	0.153	0.082	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13571	0.0	531	262	1.000	1.000	LAPM5_HUMAN Lysosomal-associated transmembrane protein 5 OS=Homo sapiens OX=9606 GN=LAPTM5 PE=1 SV=1
2	Q6P9Z7	1.20e-143	405	261	0.798	0.801	Q6P9Z7_RAT Lysosomal protein transmembrane 5 OS=Rattus norvegicus OX=10116 GN=Laptm5 PE=3 SV=1
3	Q61168	2.41e-143	404	261	0.790	0.793	LAPM5_MOUSE Lysosomal-associated transmembrane protein 5 OS=Mus musculus OX=10090 GN=Laptm5 PE=1 SV=1
4	A0A0G2K184	5.09e-126	360	257	0.718	0.732	A0A0G2K184_RAT Lysosomal protein transmembrane 5 OS=Rattus norvegicus OX=10116 GN=Laptm5 PE=3 SV=1
5	Q15012	3.38e-08	55.1	233	0.221	0.249	LAP4A_HUMAN Lysosomal-associated transmembrane protein 4A OS=Homo sapiens OX=9606 GN=LAPTM4A PE=1 SV=1
6	Q60961	9.86e-07	50.8	233	0.130	0.146	LAP4A_MOUSE Lysosomal-associated transmembrane protein 4A OS=Mus musculus OX=10090 GN=Laptm4a PE=1 SV=1
7	Q86VI4	8.35e-04	42.4	317	0.233	0.192	LAP4B_HUMAN Lysosomal-associated transmembrane protein 4B OS=Homo sapiens OX=9606 GN=LAPTM4B PE=1 SV=2
8	F7EUD8	1.1	33.1	406	0.076	0.049	F7EUD8_RAT Transient receptor ion channel domain-containing protein OS=Rattus norvegicus OX=10116 GN=Trpc6 PE=1 SV=1
9	Q8N0U2	5.5	30.4	210	0.061	0.076	TMM61_HUMAN Transmembrane protein 61 OS=Homo sapiens OX=9606 GN=TMEM61 PE=1 SV=1
10	Q75J39	6.6	30.8	901	0.065	0.019	CKI4_ORYSJ Serine/threonine-protein kinase-like protein CR4 OS=Oryza sativa subsp. japonica OX=39947 GN=CR4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15860 DUF4728	7.6e+02	12.2	Domain of unknown function (DUF4728)
2	PF03821 Mtp	1.1e-121	416.3	Golgi 4-transmembrane spanning transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294507

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227163	0.912	Transcription factor PU.1
2	9606.ENSP00000380948	0.907	Integrin beta-2
3	9606.ENSP00000271324	0.905	Leukocyte surface antigen CD53
4	9606.ENSP00000424827	0.867	E3 ubiquitin-protein ligase NEDD4
5	9606.ENSP00000262629	0.864	TYRO protein tyrosine kinase-binding protein
6	9606.ENSP00000219150	0.863	Coronin-1A
7	9606.ENSP00000175091	0.841	Lysosomal-associated transmembrane protein 4A
8	9606.ENSP00000402301	0.839	Lysosomal-associated transmembrane protein 4B
9	9606.ENSP00000320176	0.821	Hematopoietic lineage cell-specific protein
10	9606.ENSP00000357981	0.803	Cathepsin S
11	9606.ENSP00000234313	0.797	Pleckstrin
12	9606.ENSP00000313967	0.779	Complement C1q subcomponent subunit B
13	9606.ENSP00000333779	0.777	Protein EVI2B
14	9606.ENSP00000472249	0.775	Glia maturation factor gamma
15	9606.ENSP00000293373	0.747	Nck-associated protein 1-like
16	9606.ENSP00000242465	0.735	Serglycin
17	9606.ENSP00000344468	0.730	Syndecan-3
18	9606.ENSP00000369286	0.730	Lymphocyte antigen 86
19	9606.ENSP00000228945	0.728	Rho GDP-dissociation inhibitor 2
20	9606.ENSP00000333298	0.711	Lysosome-associated membrane glycoprotein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0140035	0.998	ubiquitination-like modification-dependent protein binding
GO:0031625	0.991	ubiquitin protein ligase binding
GO:0140036	0.817	ubiquitin-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0048518	0.960	positive regulation of biological process
GO:0048522	0.912	positive regulation of cellular process
GO:0006950	0.907	response to stress
GO:0048519	0.897	negative regulation of biological process
GO:0019222	0.896	regulation of metabolic process
GO:0048523	0.894	negative regulation of cellular process
GO:0065009	0.887	regulation of molecular function
GO:0045862	0.878	positive regulation of proteolysis
GO:0016043	0.869	cellular component organization
GO:0044093	0.863	positive regulation of molecular function
GO:0050790	0.802	regulation of catalytic activity
GO:0065008	0.774	regulation of biological quality
GO:0051345	0.762	positive regulation of hydrolase activity
GO:0080171	0.686	lytic vacuole organization
GO:0010950	0.666	positive regulation of endopeptidase activity
GO:0090559	0.649	regulation of membrane permeability
GO:0006919	0.645	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048583	0.605	regulation of response to stimulus
GO:0010941	0.581	regulation of cell death
GO:0051716	0.568	cellular response to stimulus
GO:0006952	0.543	defense response
GO:0002684	0.442	positive regulation of immune system process
GO:0051179	0.434	localization
GO:0048584	0.407	positive regulation of response to stimulus
GO:0051234	0.328	establishment of localization
GO:0009607	0.318	response to biotic stimulus
GO:0043067	0.316	regulation of programmed cell death
GO:0050776	0.315	regulation of immune response
GO:0051239	0.310	regulation of multicellular organismal process
GO:0023051	0.303	regulation of signaling
GO:0010646	0.301	regulation of cell communication
GO:0007040	0.301	lysosome organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005764	1.000	lysosome
GO:0005886	0.967	plasma membrane
GO:0031982	0.914	vesicle
GO:0012505	0.847	endomembrane system
GO:0031090	0.550	organelle membrane
GO:0098588	0.513	bounding membrane of organelle
GO:0031410	0.394	cytoplasmic vesicle
GO:0032991	0.386	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]