StarFunc result for job id Q13573

User Input

>input (536 residues)
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A8G7	0.777	0.777	2.344E-87	536	0.991	0.991	D4A8G7.pdb.gz	D4A8G7_RAT SNW domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Snw1 PE=1 SV=1
2	AFDB:Q32PT7	0.543	0.543	9.259E-78	536	0.836	0.836	Q32PT7.pdb.gz
3	AFDB:G3V3A4	0.544	0.515	3.642E-76	571	0.896	0.841	G3V3A4.pdb.gz	G3V3A4_HUMAN SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1
4	AFDB:P39736	0.588	0.577	1.749E-62	547	0.623	0.611	P39736.pdb.gz	BX42_DROME Puff-specific protein Bx42 OS=Drosophila melanogaster OX=7227 GN=Bx42 PE=1 SV=1
5	AFDB:A3KMS7	0.587	0.565	2.500E-56	558	0.640	0.615	A3KMS7.pdb.gz
6	AFDB:Q22836	0.571	0.572	3.400E-53	535	0.549	0.550	Q22836.pdb.gz	YGH1_CAEEL Uncharacterized protein T27F2.1 OS=Caenorhabditis elegans OX=6239 GN=T27F2.1 PE=1 SV=1
7	AFDB:Q6K8D9	0.558	0.497	1.705E-48	607	0.522	0.461	Q6K8D9.pdb.gz	SKIPA_ORYSJ SNW/SKI-interacting protein A OS=Oryza sativa subsp. japonica OX=39947 GN=SKIPA PE=1 SV=1
8	AFDB:O80653	0.526	0.470	3.148E-46	613	0.493	0.431	O80653.pdb.gz	SKIP_ARATH SNW/SKI-interacting protein OS=Arabidopsis thaliana OX=3702 GN=SKIP PE=1 SV=1
9	AFDB:Q09882	0.574	0.554	7.411E-41	557	0.457	0.440	Q09882.pdb.gz	PRP45_SCHPO Pre-mRNA-processing protein 45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp45 PE=1 SV=1
10	PDB:7w59R	0.497	0.926	8.592E-39	280	0.521	0.996	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
11	AFDB:P54705	0.540	0.438	3.168E-34	685	0.424	0.331	P54705.pdb.gz	SNWA_DICDI Protein snwA OS=Dictyostelium discoideum OX=44689 GN=snwA PE=1 SV=1
12	PDB:6ff4C	0.432	0.772	2.056E-32	286	0.532	0.997	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
13	PDB:7dvqR	0.278	0.561	1.623E-23	241	0.448	0.996	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:7aavv	0.277	0.648	1.036E-19	206	0.381	0.990	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
15	PDB:3jb9M	0.336	0.816	2.558E-15	207	0.187	0.483	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:5gm6P	0.279	0.556	6.134E-5	246	0.147	0.321	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6bk8E	0.233	0.597	4.237E-4	186	0.110	0.317	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
18	PDB:5mpsK	0.267	0.691	7.095E-4	187	0.114	0.326	5mpsK.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
19	PDB:6sgaFS	0.049	0.083	5.763E-1	277	0.035	0.069	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
20	PDB:7bt6w	0.058	0.129	1.515	182	0.052	0.154	7bt6w.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZP60	0.0	1080	536	0.983	0.983	A0A8I5ZP60_RAT SNW domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Snw1 PE=1 SV=1
2	D4A8G7	0.0	1087	536	0.991	0.991	D4A8G7_RAT SNW domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Snw1 PE=1 SV=1
3	G3V3A4	0.0	968	571	0.879	0.825	G3V3A4_HUMAN SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1
4	G3V4X8	0.0	769	374	0.698	1.000	G3V4X8_HUMAN SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1
5	P39736	0.0	593	547	0.614	0.601	BX42_DROME Puff-specific protein Bx42 OS=Drosophila melanogaster OX=7227 GN=Bx42 PE=1 SV=1
6	Q13573	0.0	1098	536	1.000	1.000	SNW1_HUMAN SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1
7	Q6DRP3	0.0	887	536	0.845	0.845	Q6DRP3_DANRE SNW domain-containing protein 1 OS=Danio rerio OX=7955 GN=fb37b08 PE=1 SV=1
8	Q9CSN1	0.0	1087	536	0.989	0.989	SNW1_MOUSE SNW domain-containing protein 1 OS=Mus musculus OX=10090 GN=Snw1 PE=1 SV=3
9	Q22836	2.48e-175	507	535	0.556	0.557	YGH1_CAEEL Uncharacterized protein T27F2.1 OS=Caenorhabditis elegans OX=6239 GN=T27F2.1 PE=1 SV=1
10	Q6K8D9	1.49e-160	472	607	0.502	0.443	SKIPA_ORYSJ SNW/SKI-interacting protein A OS=Oryza sativa subsp. japonica OX=39947 GN=SKIPA PE=1 SV=1
11	O80653	2.17e-145	433	613	0.468	0.409	SKIP_ARATH SNW/SKI-interacting protein OS=Arabidopsis thaliana OX=3702 GN=SKIP PE=1 SV=1
12	Q09882	6.43e-94	299	557	0.330	0.318	PRP45_SCHPO Pre-mRNA-processing protein 45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp45 PE=1 SV=1
13	P54705	4.85e-85	279	685	0.276	0.216	SNWA_DICDI Protein snwA OS=Dictyostelium discoideum OX=44689 GN=snwA PE=1 SV=1
14	P28004	4.57e-23	103	379	0.192	0.272	PRP45_YEAST Pre-mRNA-processing protein 45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP45 PE=1 SV=2
15	Q9TXH9	0.64	35.0	299	0.058	0.104	UBXN1_CAEEL UBX domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=ubxn-1 PE=1 SV=1
16	Q9FKN7	2.8	33.5	1613	0.054	0.018	DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana OX=3702 GN=DAR4 PE=1 SV=2
17	Q8IDX6	5.3	32.3	3130	0.037	0.006	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
18	F4I1T9	6.1	32.3	859	0.076	0.048	KN14T_ARATH Kinesin-like protein KIN-14T OS=Arabidopsis thaliana OX=3702 GN=KIN14T PE=3 SV=1
19	B9EJA2	6.6	32.3	1648	0.041	0.013	CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus OX=10090 GN=Cttnbp2 PE=1 SV=2
20	Q80W93	7.1	32.0	5154	0.039	0.004	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02731 SKIP_SNW	6.9e-70	245.3	SKIP/SNW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020381

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004393	0.998	Cell division cycle 5-like
2	61853.ENSNLEP00000006310	0.997	Elongation factor Tu GTP binding domain containing 2
3	61853.ENSNLEP00000007319	0.997	Pleiotropic regulator 1
4	61853.ENSNLEP00000008680	0.997	CWC15 spliceosome-associated protein
5	61853.ENSNLEP00000013106	0.997	Peptidyl-prolyl cis-trans isomerase
6	61853.ENSNLEP00000001136	0.996	XPA binding protein 2
7	61853.ENSNLEP00000007640	0.996	CWC22 spliceosome-associated protein
8	61853.ENSNLEP00000012045	0.996	Crooked neck pre-mRNA splicing factor 1
9	61853.ENSNLEP00000001053	0.995	pre-mRNA processing factor 8
10	61853.ENSNLEP00000002730	0.995	Small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
11	61853.ENSNLEP00000007065	0.994	Small nuclear ribonucleoprotein polypeptide F
12	61853.ENSNLEP00000008303	0.994	Small nuclear ribonucleoprotein D1 polypeptide 16kDa
13	61853.ENSNLEP00000011011	0.994	SYF2 pre-mRNA-splicing factor
14	61853.ENSNLEP00000015525	0.994	Cell division cycle 40
15	61853.ENSNLEP00000016546	0.994	pre-mRNA processing factor 19
16	61853.ENSNLEP00000022846	0.994	Small nuclear ribonucleoprotein polypeptide E
17	61853.ENSNLEP00000000576	0.993	Small nuclear ribonucleoprotein polypeptide A'
18	61853.ENSNLEP00000013419	0.993	BUD31 homolog (S. cerevisiae)
19	61853.ENSNLEP00000012663	0.992	RNA binding motif protein 22
20	61853.ENSNLEP00000018945	0.992	Small nuclear ribonucleoprotein D3 polypeptide 18kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.655	nucleic acid binding
GO:0003723	0.496	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.961	regulation of biological process
GO:0050794	0.890	regulation of cellular process
GO:0032502	0.855	developmental process
GO:0032501	0.816	multicellular organismal process
GO:0048856	0.796	anatomical structure development
GO:0048869	0.774	cellular developmental process
GO:0008152	0.757	metabolic process
GO:0071704	0.734	organic substance metabolic process
GO:0048518	0.659	positive regulation of biological process
GO:0007275	0.647	multicellular organism development
GO:0030154	0.645	cell differentiation
GO:0044238	0.634	primary metabolic process
GO:0006807	0.620	nitrogen compound metabolic process
GO:0043170	0.612	macromolecule metabolic process
GO:0048522	0.609	positive regulation of cellular process
GO:0044237	0.552	cellular metabolic process
GO:1901360	0.520	organic cyclic compound metabolic process
GO:0034641	0.520	cellular nitrogen compound metabolic process
GO:0090304	0.505	nucleic acid metabolic process
GO:0008380	0.493	RNA splicing
GO:0006397	0.491	mRNA processing
GO:0019222	0.458	regulation of metabolic process
GO:0060255	0.444	regulation of macromolecule metabolic process
GO:0048583	0.436	regulation of response to stimulus
GO:0014009	0.399	glial cell proliferation
GO:0050896	0.362	response to stimulus
GO:0000377	0.345	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0010468	0.338	regulation of gene expression
GO:0000398	0.336	mRNA splicing, via spliceosome
GO:0051171	0.326	regulation of nitrogen compound metabolic process
GO:0031323	0.325	regulation of cellular metabolic process
GO:0080090	0.320	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0140513	0.851	nuclear protein-containing complex
GO:0005737	0.831	cytoplasm
GO:1990904	0.821	ribonucleoprotein complex
GO:0005681	0.807	spliceosomal complex
GO:1902494	0.784	catalytic complex
GO:0005684	0.575	U2-type spliceosomal complex
GO:0016604	0.551	nuclear body
GO:0071013	0.438	catalytic step 2 spliceosome
GO:0005694	0.329	chromosome
GO:0005829	0.303	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]