StarFunc result for job id Q13574

User Input

>input (928 residues)
MEPRDGSPEARSSDSESASASSSGSERDAGPEPDKAPRRLNKRRFPGLRLFGHRKAITKS
GLQHLAPPPPTPGAPCSESERQIRSTVDWSESATYGEHIWFETNVSGDFCYVGEQYCVAR
MLKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNVREPTFVRHHWVHRRRQ
DGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCSLGVHAAVVI
PPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSPLMKPLLVFV
NPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWI
LSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWD
LHAEPNPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRN
KMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCVVFLNIPRYCAGTMPW
GHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLTTSKAIPVQVD
GEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDYEALH
YDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDA
TTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPR
SLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVR
YLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEK
AQDTELAAYLENRQHYQMIQREDQETAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YWQ0	0.632	0.552	0.000	1071	0.625	0.542	D3YWQ0.pdb.gz	DGKI_MOUSE Diacylglycerol kinase iota OS=Mus musculus OX=10090 GN=Dgki PE=1 SV=1
2	AFDB:F1MAB7	0.633	0.563	0.000	1050	0.637	0.563	F1MAB7.pdb.gz	DGKI_RAT Diacylglycerol kinase iota OS=Rattus norvegicus OX=10116 GN=Dgki PE=1 SV=1
3	AFDB:O08560	0.818	0.817	0.000	929	0.968	0.967	O08560.pdb.gz	DGKZ_RAT Diacylglycerol kinase zeta OS=Rattus norvegicus OX=10116 GN=Dgkz PE=1 SV=1
4	AFDB:P49619	0.486	0.567	4.421E-49	791	0.222	0.260	P49619.pdb.gz	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
5	AFDB:P49620	0.486	0.569	3.429E-47	788	0.202	0.237	P49620.pdb.gz	DGKG_RAT Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=1 SV=1
6	AFDB:P23743	0.488	0.612	1.891E-46	735	0.192	0.242	P23743.pdb.gz	DGKA_HUMAN Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3
7	AFDB:O88673	0.477	0.601	5.151E-45	730	0.192	0.244	O88673.pdb.gz	DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus OX=10090 GN=Dgka PE=1 SV=2
8	AFDB:Q01583	0.474	0.366	5.035E-42	1211	0.204	0.156	Q01583.pdb.gz	DGK1_DROME Diacylglycerol kinase 1 OS=Drosophila melanogaster OX=7227 GN=Dgk PE=2 SV=5
9	AFDB:Q9FFN7	0.451	0.582	3.346E-39	712	0.189	0.246	Q9FFN7.pdb.gz	DGK2_ARATH Diacylglycerol kinase 2 OS=Arabidopsis thaliana OX=3702 GN=DGK2 PE=1 SV=1
10	AFDB:D3ZEY4	0.442	0.438	1.950E-38	937	0.217	0.215	D3ZEY4.pdb.gz	DGKQ_RAT Diacylglycerol kinase theta OS=Rattus norvegicus OX=10116 GN=Dgkq PE=1 SV=1
11	PDB:4l02A	0.248	0.579	2.447E-11	360	0.057	0.147	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
12	PDB:2bonA	0.220	0.623	1.523E-9	287	0.058	0.188	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
13	PDB:2bonB	0.216	0.665	1.796E-9	265	0.057	0.200	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
14	PDB:7cgpB	0.223	0.516	1.796E-9	345	0.050	0.133	7cgpB.pdb.gz
15	PDB:2qv7A	0.220	0.597	2.791E-9	303	0.054	0.165	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
16	PDB:3ehqA	0.119	0.584	6.515E-7	182	0.034	0.176	3ehqA.pdb.gz
17	PDB:1u0tB	0.174	0.482	9.066E-7	276	0.050	0.167	1u0tB.pdb.gz
18	PDB:8cs9A	0.123	0.143	1.069E-6	796	0.036	0.041	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
19	PDB:4oauC	0.127	0.169	2.728E-6	692	0.036	0.048	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
20	PDB:1bd8A	0.121	0.653	6.958E-6	156	0.032	0.192	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YWQ0	0.0	1206	1071	0.635	0.550	DGKI_MOUSE Diacylglycerol kinase iota OS=Mus musculus OX=10090 GN=Dgki PE=1 SV=1
2	E9PNL8	0.0	1467	707	0.762	1.000	E9PNL8_HUMAN Diacylglycerol kinase OS=Homo sapiens OX=9606 GN=DGKZ PE=1 SV=1
3	F1MAB7	0.0	1216	1050	0.634	0.560	DGKI_RAT Diacylglycerol kinase iota OS=Rattus norvegicus OX=10116 GN=Dgki PE=1 SV=1
4	O08560	0.0	1871	929	0.971	0.970	DGKZ_RAT Diacylglycerol kinase zeta OS=Rattus norvegicus OX=10116 GN=Dgkz PE=1 SV=1
5	O75912	0.0	1180	1065	0.624	0.544	DGKI_HUMAN Diacylglycerol kinase iota OS=Homo sapiens OX=9606 GN=DGKI PE=1 SV=1
6	Q09103	0.0	669	1457	0.399	0.254	DGK2_DROME Eye-specific diacylglycerol kinase OS=Drosophila melanogaster OX=7227 GN=rdgA PE=2 SV=2
7	Q13574	0.0	1933	928	1.000	1.000	DGKZ_HUMAN Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ PE=1 SV=4
8	Q80UP3	0.0	1776	929	0.957	0.956	DGKZ_MOUSE Diacylglycerol kinase zeta OS=Mus musculus OX=10090 GN=Dgkz PE=1 SV=2
9	Q6NS52	3.61e-89	303	802	0.210	0.243	DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2
10	P49620	6.44e-89	302	788	0.211	0.249	DGKG_RAT Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=1 SV=1
11	Q03603	2.87e-88	301	795	0.204	0.238	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3
12	P49621	1.12e-87	299	801	0.210	0.243	DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1
13	P49619	1.33e-87	299	791	0.211	0.248	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
14	Q9Y6T7	4.04e-87	298	804	0.206	0.238	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
15	Q91WG7	2.77e-85	292	788	0.209	0.246	DGKG_MOUSE Diacylglycerol kinase gamma OS=Mus musculus OX=10090 GN=Dgkg PE=1 SV=1
16	P23743	6.09e-82	282	735	0.192	0.242	DGKA_HUMAN Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3
17	P20192	6.53e-82	282	734	0.196	0.248	DGKA_PIG Diacylglycerol kinase alpha OS=Sus scrofa OX=9823 GN=DGKA PE=1 SV=1
18	O88673	3.30e-75	263	730	0.205	0.260	DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus OX=10090 GN=Dgka PE=1 SV=2
19	P51556	1.30e-74	261	727	0.192	0.245	DGKA_RAT Diacylglycerol kinase alpha OS=Rattus norvegicus OX=10116 GN=Dgka PE=1 SV=1
20	Q58AU6	6.79e-68	244	794	0.163	0.190	Q58AU6_CAEEL Diacylglycerol kinase OS=Caenorhabditis elegans OX=6239 GN=dgk-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.014	27.0	Ankyrin repeat
2	PF12796 Ank_2	1.4e-08	46.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.2e-05	35.3	Ankyrin repeat
4	PF13637 Ank_4	1.2e-05	37.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4.9e-06	38.0	Ankyrin repeats (many copies)
6	PF00130 C1_1	3.3e-09	47.8	Phorbol esters/diacylglycerol binding domain (C1 domain)
7	PF00609 DAGK_acc	1.8e-43	160.1	Diacylglycerol kinase accessory domain
8	PF00781 DAGK_cat	1.1e-26	104.3	Diacylglycerol kinase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001973

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012759	0.900	Key enzyme in triglyceride metabolism. Catalyzes the hydrolysis of triglycerides from circulating chylomicrons and very low density lipoproteins (VLDL), and thereby plays an important role in lipid clearance from the blood stream, lipid utilization and storage. Mediates margination of triglyceride-rich lipoprotein particles in capillaries. Recruited to its site of action on the luminal surface of vascular endothelium by binding to GPIHBP1 and cell surface heparan sulfate proteoglycans
2	60711.ENSCSAP00000006550	0.838	Glyceronephosphate O-acyltransferase
3	60711.ENSCSAP00000012031	0.823	Glycerol-3-phosphate dehydrogenase 2 (mitochondrial)
4	60711.ENSCSAP00000009193	0.798	Phospholipase D2
5	60711.ENSCSAP00000009568	0.795	Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin
6	60711.ENSCSAP00000000712	0.794	Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin
7	60711.ENSCSAP00000010095	0.784	Phospholipase C, gamma 1
8	60711.ENSCSAP00000003285	0.773	Phospholipase C, beta 3 (phosphatidylinositol-specific)
9	60711.ENSCSAP00000003642	0.773	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
10	60711.ENSCSAP00000009747	0.773	Phospholipase C, beta 1 (phosphoinositide-specific)
11	60711.ENSCSAP00000009769	0.773	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
12	60711.ENSCSAP00000008945	0.772	Phospholipase D1, phosphatidylcholine-specific
13	60711.ENSCSAP00000016220	0.752	Sorting nexin family member 27
14	60711.ENSCSAP00000000030	0.745	Phospholipase C, delta 3
15	60711.ENSCSAP00000002510	0.745	Phospholipase C, epsilon 1
16	60711.ENSCSAP00000005045	0.745	Phospholipase C, delta 4
17	60711.ENSCSAP00000010332	0.745	Phospholipase C, delta 1
18	60711.ENSCSAP00000014625	0.731	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
19	60711.ENSCSAP00000006222	0.704	Dystrophin related protein 2
20	60711.ENSCSAP00000004814	0.700	Diacylglycerol O-acyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004143	1.000	diacylglycerol kinase activity
GO:0019899	0.381	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:1901576	0.995	organic substance biosynthetic process
GO:0006796	0.995	phosphate-containing compound metabolic process
GO:0019637	0.995	organophosphate metabolic process
GO:0046486	0.995	glycerolipid metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0030258	0.994	lipid modification
GO:0008654	0.992	phospholipid biosynthetic process
GO:0046473	0.991	phosphatidic acid metabolic process
GO:0050896	0.989	response to stimulus
GO:0023052	0.989	signaling
GO:0007154	0.989	cell communication
GO:0006654	0.978	phosphatidic acid biosynthetic process
GO:0032501	0.973	multicellular organismal process
GO:0048519	0.973	negative regulation of biological process
GO:0048518	0.956	positive regulation of biological process
GO:0048523	0.944	negative regulation of cellular process
GO:0065009	0.942	regulation of molecular function
GO:0007165	0.940	signal transduction
GO:0035556	0.932	intracellular signal transduction
GO:0019222	0.927	regulation of metabolic process
GO:0044093	0.926	positive regulation of molecular function
GO:0048522	0.925	positive regulation of cellular process
GO:0019220	0.924	regulation of phosphate metabolic process
GO:0065008	0.908	regulation of biological quality
GO:0006639	0.888	acylglycerol metabolic process
GO:0051338	0.887	regulation of transferase activity
GO:0001775	0.879	cell activation
GO:0042325	0.851	regulation of phosphorylation
GO:0050878	0.843	regulation of body fluid levels
GO:0030168	0.834	platelet activation
GO:0043549	0.799	regulation of kinase activity
GO:0016310	0.795	phosphorylation
GO:0043550	0.774	regulation of lipid kinase activity
GO:0048583	0.657	regulation of response to stimulus
GO:0009893	0.657	positive regulation of metabolic process
GO:0009966	0.593	regulation of signal transduction
GO:0043085	0.527	positive regulation of catalytic activity
GO:0071840	0.524	cellular component organization or biogenesis
GO:0016043	0.478	cellular component organization
GO:0031325	0.454	positive regulation of cellular metabolic process
GO:0051179	0.435	localization
GO:0045937	0.432	positive regulation of phosphate metabolic process
GO:0051234	0.375	establishment of localization
GO:0046339	0.365	diacylglycerol metabolic process
GO:0080090	0.339	regulation of primary metabolic process
GO:0051347	0.332	positive regulation of transferase activity
GO:0042327	0.331	positive regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.996	membrane
GO:0005737	0.991	cytoplasm
GO:0005886	0.990	plasma membrane
GO:0005634	0.990	nucleus
GO:0030054	0.974	cell junction
GO:0005829	0.973	cytosol
GO:0045202	0.946	synapse
GO:0012505	0.940	endomembrane system
GO:0043233	0.830	organelle lumen
GO:0070013	0.824	intracellular organelle lumen
GO:0031981	0.814	nuclear lumen
GO:0005654	0.803	nucleoplasm
GO:0031090	0.802	organelle membrane
GO:0098978	0.692	glutamatergic synapse
GO:0098794	0.551	postsynapse
GO:0120025	0.497	plasma membrane bounded cell projection
GO:0014069	0.421	postsynaptic density
GO:0031982	0.313	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10272	1.000	a 1,2-diacyl-sn-glycerol + ATP = a 1,2-diacyl-sn-glycero-3-phosphate + ADP + H(+)
EC:2.7.1.107	1.000	diacylglycerol kinase (ATP).

[back to server]