StarFunc result for job id Q13586

User Input

>input (685 residues)
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSED
EKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDL
WKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLK
MTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEH
MKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRL
KELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQ
YYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQM
SRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELS
PSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGS
IGEETDSSPGRKKFPLKIFKKPLKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70302	0.447	0.447	5.845E-81	685	0.966	0.966	P70302.pdb.gz	STIM1_MOUSE Stromal interaction molecule 1 OS=Mus musculus OX=10090 GN=Stim1 PE=1 SV=2
2	AFDB:H0YDB2	0.313	0.301	1.877E-79	716	0.991	0.948	H0YDB2.pdb.gz	H0YDB2_HUMAN Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=2
3	AFDB:G0XQ39	0.306	0.267	5.895E-77	791	0.999	0.865	G0XQ39.pdb.gz	G0XQ39_HUMAN STIM1L OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=1
4	AFDB:A0A2R8RIM0	0.310	0.303	8.746E-55	703	0.638	0.622	A0A2R8RIM0.pdb.gz	A0A2R8RIM0_DANRE Stromal interaction molecule 1 isoform X3 OS=Danio rerio OX=7955 GN=si:dkey-24p1.5 PE=1 SV=1
5	AFDB:Q1LY88	0.288	0.292	3.425E-53	676	0.636	0.645	Q1LY88.pdb.gz	Q1LY88_DANRE Stromal interaction molecule 1 precursor OS=Danio rerio OX=7955 GN=si:dkey-24p1.5 PE=1 SV=1
6	AFDB:D4A5X1	0.378	0.354	1.371E-41	743	0.476	0.439	D4A5X1.pdb.gz	D4A5X1_RAT Stromal interaction molecule 2 OS=Rattus norvegicus OX=10116 GN=Stim2 PE=1 SV=3
7	AFDB:Q8CIS0	0.084	0.057	1.814E-3	1159	0.158	0.093	Q8CIS0.pdb.gz	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
8	AFDB:A4GSN8	0.148	0.055	2.834E-3	2093	0.165	0.054	A4GSN8.pdb.gz	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
9	AFDB:Q5F3W0	0.087	0.056	3.129E-3	1170	0.143	0.084	Q5F3W0.pdb.gz	Q5F3W0_CHICK CARD domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_5k17 PE=2 SV=1
10	AFDB:Q6UVJ0	0.119	0.123	8.861E-3	657	0.124	0.129	Q6UVJ0.pdb.gz	SAS6_HUMAN Spindle assembly abnormal protein 6 homolog OS=Homo sapiens OX=9606 GN=SASS6 PE=1 SV=1
11	PDB:3bs5A	0.096	0.678	3.123E-2	86	0.032	0.256	3bs5A.pdb.gz
12	PDB:2lhiA	0.119	0.348	1.026E-1	176	0.031	0.119	2lhiA.pdb.gz	Solution structures of yeast Saccharomyces cerevisiae calmodulin in calcium- and target peptide-bound states reveal similarities and differences to vertebrate calmodulin.
13	PDB:7cm7A	0.098	0.108	2.905E-1	620	0.036	0.040	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
14	PDB:5x9aB	0.112	0.321	1.003	198	0.045	0.157	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition
15	PDB:2ct9B	0.115	0.337	1.223	198	0.044	0.152	2ct9B.pdb.gz	Structural characterization of calcineurin B homologous protein 1
16	PDB:6tz8B	0.102	0.332	1.567	174	0.038	0.149	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
17	PDB:6zmwu	0.105	0.103	1.567	706	0.083	0.081	6zmwu.pdb.gz	Structure of a human 48Stranslational initiation complex.
18	PDB:1a2xA	0.092	0.252	1.818	158	0.034	0.146	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
19	PDB:4gwpA	0.098	0.412	1.911	112	0.022	0.134	4gwpA.pdb.gz
20	PDB:2g2bA	0.111	0.413	2.110	150	0.026	0.120	2g2bA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RIM0	0.0	769	703	0.634	0.617	A0A2R8RIM0_DANRE Stromal interaction molecule 1 isoform X3 OS=Danio rerio OX=7955 GN=si:dkey-24p1.5 PE=1 SV=1
2	A0A8I6A6S4	0.0	570	817	0.412	0.345	A0A8I6A6S4_RAT Stromal interaction molecule 2 OS=Rattus norvegicus OX=10116 GN=Stim2 PE=1 SV=1
3	A0A8I6AK33	0.0	576	714	0.413	0.396	A0A8I6AK33_RAT Stromal interaction molecule 2 OS=Rattus norvegicus OX=10116 GN=Stim2 PE=1 SV=1
4	D4A5X1	0.0	577	809	0.412	0.349	D4A5X1_RAT Stromal interaction molecule 2 OS=Rattus norvegicus OX=10116 GN=Stim2 PE=1 SV=3
5	E9PNJ4	0.0	1049	512	0.747	1.000	E9PNJ4_HUMAN Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=1
6	G0XQ39	0.0	1069	791	0.750	0.650	G0XQ39_HUMAN STIM1L OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=1
7	H0YDB2	0.0	1310	716	0.999	0.955	H0YDB2_HUMAN Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=2
8	P70302	0.0	1368	685	0.968	0.968	STIM1_MOUSE Stromal interaction molecule 1 OS=Mus musculus OX=10090 GN=Stim1 PE=1 SV=2
9	P83093	0.0	575	746	0.412	0.378	STIM2_MOUSE Stromal interaction molecule 2 OS=Mus musculus OX=10090 GN=Stim2 PE=1 SV=2
10	P84903	0.0	1373	685	0.969	0.969	STIM1_RAT Stromal interaction molecule 1 OS=Rattus norvegicus OX=10116 GN=Stim1 PE=1 SV=1
11	Q13586	0.0	1412	685	1.000	1.000	STIM1_HUMAN Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3
12	Q1LY88	0.0	785	676	0.635	0.643	Q1LY88_DANRE Stromal interaction molecule 1 precursor OS=Danio rerio OX=7955 GN=si:dkey-24p1.5 PE=1 SV=1
13	Q9P246	0.0	572	746	0.410	0.377	STIM2_HUMAN Stromal interaction molecule 2 OS=Homo sapiens OX=9606 GN=STIM2 PE=1 SV=2
14	P83094	5.70e-108	340	570	0.282	0.339	STIM_DROME Stromal interaction molecule homolog OS=Drosophila melanogaster OX=7227 GN=Stim PE=1 SV=1
15	G5EF60	3.17e-46	174	530	0.175	0.226	STIM1_CAEEL Stromal interaction molecule 1 OS=Caenorhabditis elegans OX=6239 GN=stim-1 PE=1 SV=1
16	Q8IDX6	0.023	40.8	3130	0.051	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
17	Q9M3G7	0.24	37.4	3856	0.055	0.010	ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana OX=3702 GN=ATM PE=1 SV=1
18	Q13751	0.27	37.0	1172	0.063	0.037	LAMB3_HUMAN Laminin subunit beta-3 OS=Homo sapiens OX=9606 GN=LAMB3 PE=1 SV=1
19	Q8ML92	0.58	33.5	106	0.029	0.189	AVE_DROME Protein aveugle OS=Drosophila melanogaster OX=7227 GN=ave PE=1 SV=1
20	Q9C778	1.1	34.7	355	0.041	0.079	ELP4_ARATH Elongator complex protein 4 OS=Arabidopsis thaliana OX=3702 GN=ELP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	0.25	23.1	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	0.00083	30.7	SAM domain (Sterile alpha motif)
3	PF09235 SAM_Ste50p	2.8e+02	13.2	Ste50p, sterile alpha motif
4	PF16533 SOAR	2.2e-41	151.2	STIM1 Orai1-activating region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021023

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000019475	0.985	ORAI calcium release-activated calcium modulator 3
2	61853.ENSNLEP00000010148	0.984	ORAI calcium release-activated calcium modulator 2
3	61853.ENSNLEP00000005912	0.936	Transient receptor potential cation channel, subfamily C, member 1
4	61853.ENSNLEP00000004432	0.884	Inositol 1,4,5-trisphosphate receptor, type 1
5	61853.ENSNLEP00000010258	0.843	Inositol 1,4,5-trisphosphate receptor, type 3
6	61853.ENSNLEP00000023188	0.843	Uncharacterized protein
7	61853.ENSNLEP00000020597	0.837	Stromal interaction molecule 2
8	61853.ENSNLEP00000011420	0.799	Transient receptor potential cation channel, subfamily C, member 3
9	61853.ENSNLEP00000003076	0.796	Transient receptor potential cation channel, subfamily C, member 4
10	61853.ENSNLEP00000008719	0.796	Transient receptor potential cation channel, subfamily C, member 6
11	61853.ENSNLEP00000017771	0.796	Transient receptor potential cation channel, subfamily C, member 5
12	61853.ENSNLEP00000006493	0.783	Inositol 1,4,5-trisphosphate receptor, type 2
13	61853.ENSNLEP00000011980	0.760	Microtubule-associated protein, RP/EB family, member 1
14	61853.ENSNLEP00000010320	0.759	Transient receptor potential cation channel, subfamily C, member 7
15	61853.ENSNLEP00000006562	0.726	Protein disulfide isomerase family A, member 3
16	61853.ENSNLEP00000014437	0.714	Store-operated calcium entry-associated regulatory factor
17	61853.ENSNLEP00000014017	0.710	May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (By similarity). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (By [...]
18	61853.ENSNLEP00000003335	0.694	Voltage-dependent L-type calcium channel subunit alpha
19	61853.ENSNLEP00000015683	0.684	Thrombospondin 4
20	61853.ENSNLEP00000003655	0.660	Calcium release activated channel regulator 2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005246	1.000	calcium channel regulator activity
GO:0042802	0.992	identical protein binding
GO:0140677	0.888	molecular function activator activity
GO:0099103	0.882	channel activator activity
GO:0099107	0.563	ion channel regulator activity involved in G protein-coupled receptor signaling pathway
GO:0015075	0.488	monoatomic ion transmembrane transporter activity
GO:0015318	0.465	inorganic molecular entity transmembrane transporter activity
GO:0046873	0.464	metal ion transmembrane transporter activity
GO:1901702	0.457	salt transmembrane transporter activity
GO:0015267	0.446	channel activity
GO:0005216	0.431	monoatomic ion channel activity
GO:0005261	0.415	monoatomic cation channel activity
GO:0015085	0.414	calcium ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051179	0.995	localization
GO:0051234	0.992	establishment of localization
GO:1901019	0.989	regulation of calcium ion transmembrane transporter activity
GO:2001259	0.989	positive regulation of cation channel activity
GO:1904427	0.985	positive regulation of calcium ion transmembrane transport
GO:1901021	0.976	positive regulation of calcium ion transmembrane transporter activity
GO:0006810	0.965	transport
GO:0006811	0.960	monoatomic ion transport
GO:0050896	0.953	response to stimulus
GO:0006816	0.934	calcium ion transport
GO:0009987	0.893	cellular process
GO:0042221	0.867	response to chemical
GO:0032502	0.827	developmental process
GO:0048856	0.785	anatomical structure development
GO:0032501	0.535	multicellular organismal process
GO:0010033	0.484	response to organic substance
GO:1901700	0.466	response to oxygen-containing compound
GO:0051716	0.440	cellular response to stimulus
GO:0065008	0.433	regulation of biological quality
GO:0009719	0.351	response to endogenous stimulus
GO:0010243	0.348	response to organonitrogen compound
GO:0070887	0.347	cellular response to chemical stimulus
GO:1901701	0.328	cellular response to oxygen-containing compound
GO:0071495	0.317	cellular response to endogenous stimulus
GO:0007275	0.316	multicellular organism development
GO:0071310	0.313	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.968	membrane
GO:0071944	0.941	cell periphery
GO:0005886	0.924	plasma membrane
GO:0032991	0.583	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.414	Ca(2+)(in) = Ca(2+)(out)

[back to server]