StarFunc result for job id Q13591

User Input

>input (1074 residues)
MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY
AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTFFLPEL
DLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPNPNPHFQCGTV
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII
YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVV
KIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVD
GHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
PWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNPCPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS
EWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q0G5	0.529	0.592	0.000	955	0.492	0.553	A0A2R8Q0G5.pdb.gz
2	AFDB:F1QPQ6	0.568	0.555	0.000	1101	0.547	0.533	F1QPQ6.pdb.gz	F1QPQ6_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba OS=Danio rerio OX=7955 GN=sema5ba PE=4 SV=1
3	AFDB:F1R9L1	0.749	0.747	0.000	1078	0.782	0.779	F1R9L1.pdb.gz	F1R9L1_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A OS=Danio rerio OX=7955 GN=wu:fa95e03 PE=4 SV=3
4	AFDB:Q60519	0.521	0.512	0.000	1093	0.572	0.562	Q60519.pdb.gz	SEM5B_MOUSE Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b PE=2 SV=2
5	AFDB:Q62217	0.584	0.582	0.000	1077	0.936	0.933	Q62217.pdb.gz	SEM5A_MOUSE Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a PE=2 SV=1
6	AFDB:Q9VTT0	0.473	0.465	1.537E-92	1093	0.343	0.337	Q9VTT0.pdb.gz	SEM5C_DROME Semaphorin 5c OS=Drosophila melanogaster OX=7227 GN=Sema5c PE=1 SV=3
7	AFDB:Q64151	0.445	0.568	6.391E-46	834	0.181	0.233	Q64151.pdb.gz	SEM4C_MOUSE Semaphorin-4C OS=Mus musculus OX=10090 GN=Sema4c PE=1 SV=1
8	AFDB:A0A2R8Q5P4	0.439	0.617	1.984E-45	756	0.172	0.245	A0A2R8Q5P4.pdb.gz
9	AFDB:Q9C0C4	0.441	0.564	2.286E-45	833	0.180	0.232	Q9C0C4.pdb.gz	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2
10	AFDB:Q9H3T3	0.433	0.521	2.286E-45	888	0.178	0.215	Q9H3T3.pdb.gz	SEM6B_HUMAN Semaphorin-6B OS=Homo sapiens OX=9606 GN=SEMA6B PE=1 SV=4
11	PDB:6qp7A	0.417	0.712	1.092E-42	620	0.172	0.298	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	PDB:3nvqA	0.380	0.667	3.705E-29	588	0.137	0.250	3nvqA.pdb.gz
13	PDB:6vxkB	0.311	0.436	4.968E-19	747	0.115	0.166	6vxkB.pdb.gz
14	PDB:1w0rA	0.061	0.138	3.822E-17	442	0.112	0.271	1w0rA.pdb.gz
15	PDB:3nvnA	0.304	0.786	9.371E-17	383	0.064	0.180	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
16	PDB:3k6sC	0.197	0.233	6.984E-9	885	0.083	0.101	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
17	PDB:7uslA	0.217	0.266	1.882E-8	856	0.083	0.104	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
18	PDB:7nxdA	0.211	0.244	6.732E-8	905	0.087	0.103	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
19	PDB:6jp6A	0.132	0.140	1.244E-7	998	0.076	0.082	6jp6A.pdb.gz
20	PDB:7ajuUL	0.183	0.238	5.125E-7	779	0.061	0.085	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IMM9	0.0	1695	1048	0.740	0.759	A0A0R4IMM9_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A OS=Danio rerio OX=7955 GN=wu:fa95e03 PE=4 SV=1
2	D3ZTD8	0.0	2095	1074	0.937	0.937	SEM5A_RAT Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sema5a PE=1 SV=1
3	F1QPQ6	0.0	1244	1101	0.555	0.541	F1QPQ6_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba OS=Danio rerio OX=7955 GN=sema5ba PE=4 SV=1
4	F1R9L1	0.0	1787	1078	0.780	0.777	F1R9L1_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A OS=Danio rerio OX=7955 GN=wu:fa95e03 PE=4 SV=3
5	Q13591	0.0	2239	1074	1.000	1.000	SEM5A_HUMAN Semaphorin-5A OS=Homo sapiens OX=9606 GN=SEMA5A PE=1 SV=3
6	Q60519	0.0	1315	1093	0.568	0.558	SEM5B_MOUSE Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b PE=2 SV=2
7	Q62217	0.0	2083	1077	0.936	0.933	SEM5A_MOUSE Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a PE=2 SV=1
8	Q9VTT0	0.0	634	1093	0.336	0.330	SEM5C_DROME Semaphorin 5c OS=Drosophila melanogaster OX=7227 GN=Sema5c PE=1 SV=3
9	Q24322	3.67e-92	317	899	0.191	0.228	SEM1A_DROME Semaphorin-1A OS=Drosophila melanogaster OX=7227 GN=Sema1a PE=1 SV=3
10	O35464	5.70e-91	316	1031	0.186	0.194	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
11	Q9H2E6	9.02e-91	315	1030	0.182	0.190	SEM6A_HUMAN Semaphorin-6A OS=Homo sapiens OX=9606 GN=SEMA6A PE=1 SV=3
12	Q6P7E1	3.52e-90	313	968	0.169	0.187	Q6P7E1_DANRE Semaphorin-6A precursor OS=Danio rerio OX=7955 GN=zgc:66106 PE=2 SV=1
13	Q9H3T3	2.63e-89	308	888	0.180	0.217	SEM6B_HUMAN Semaphorin-6B OS=Homo sapiens OX=9606 GN=SEMA6B PE=1 SV=4
14	O54951	2.33e-88	306	886	0.180	0.218	SEM6B_MOUSE Semaphorin-6B OS=Mus musculus OX=10090 GN=Sema6b PE=1 SV=1
15	E3W9A6	7.40e-87	305	1064	0.182	0.183	E3W9A6_DANRE Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6E OS=Danio rerio OX=7955 GN=bZ1N7.1 PE=2 SV=1
16	Q8NFY4	1.34e-85	301	1073	0.162	0.162	SEM6D_HUMAN Semaphorin-6D OS=Homo sapiens OX=9606 GN=SEMA6D PE=1 SV=1
17	Q76KF0	1.06e-84	299	1073	0.165	0.165	SEM6D_MOUSE Semaphorin-6D OS=Mus musculus OX=10090 GN=Sema6d PE=1 SV=1
18	Q9H3T2	4.37e-81	286	930	0.172	0.199	SEM6C_HUMAN Semaphorin-6C OS=Homo sapiens OX=9606 GN=SEMA6C PE=2 SV=4
19	Q24323	4.76e-78	273	724	0.173	0.257	SEM2A_DROME Semaphorin-2A OS=Drosophila melanogaster OX=7227 GN=Sema2a PE=1 SV=2
20	Q9C0C4	4.83e-78	276	833	0.163	0.210	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01403 Sema	4.7e-39	145.6	Sema domain
2	PF19030 TSP1_ADAMTS	0.0049	28.4	Thrombospondin type 1 domain
3	PF19035 TSP1_CCN	1.4	20.6	CCN3 Nov like TSP1 domain
4	PF19028 TSP1_spondin	1.9e-24	97.0	Spondin-like TSP1 domain
5	PF00090 TSP_1	4.2e-43	156.6	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371936

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
2	9606.ENSP00000442736	0.929	Plexin-B3
3	9606.ENSP00000358696	0.922	Plexin-A3
4	9606.ENSP00000460236	0.915	Spondin-1
5	9606.ENSP00000260356	0.910	Thrombospondin-1
6	9606.ENSP00000284984	0.910	A disintegrin and metalloproteinase with thrombospondin motifs 1
7	9606.ENSP00000297354	0.909	Somatomedin-B and thrombospondin type-1 domain-containing protein
8	9606.ENSP00000355751	0.909	Thrombospondin-2
9	9606.ENSP00000247153	0.907	Properdin
10	9606.ENSP00000272643	0.907	Thrombospondin type-1 domain-containing protein 7B
11	9606.ENSP00000418735	0.907	A disintegrin and metalloproteinase with thrombospondin motifs 9
12	9606.ENSP00000422554	0.907	A disintegrin and metalloproteinase with thrombospondin motifs 12
13	9606.ENSP00000274181	0.906	ADAM metallopeptidase with thrombospondin type 1 motif 16
14	9606.ENSP00000369921	0.906	ADAMTS-like protein 1
15	9606.ENSP00000356975	0.905	A disintegrin and metalloproteinase with thrombospondin motifs 4
16	9606.ENSP00000406482	0.905	Thrombospondin type-1 domain-containing protein 7A
17	9606.ENSP00000483599	0.905	Spondin-2
18	9606.ENSP00000284987	0.904	A disintegrin and metalloproteinase with thrombospondin motifs 5
19	9606.ENSP00000389588	0.904	Semaphorin-5B
20	9606.ENSP00000251582	0.903	A disintegrin and metalloproteinase with thrombospondin motifs 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030215	0.999	semaphorin receptor binding
GO:0097367	0.996	carbohydrate derivative binding
GO:0008046	0.995	axon guidance receptor activity
GO:0005539	0.994	glycosaminoglycan binding
GO:1901681	0.982	sulfur compound binding
GO:0043394	0.811	proteoglycan binding
GO:0043395	0.780	heparan sulfate proteoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0032501	0.989	multicellular organismal process
GO:0048856	0.988	anatomical structure development
GO:0007275	0.978	multicellular organism development
GO:0048731	0.971	system development
GO:0065007	0.954	biological regulation
GO:0007399	0.929	nervous system development
GO:0050789	0.925	regulation of biological process
GO:0071840	0.907	cellular component organization or biogenesis
GO:0050794	0.904	regulation of cellular process
GO:0016043	0.902	cellular component organization
GO:0030154	0.885	cell differentiation
GO:0009653	0.855	anatomical structure morphogenesis
GO:0048468	0.814	cell development
GO:0030182	0.799	neuron differentiation
GO:0048666	0.792	neuron development
GO:0030030	0.740	cell projection organization
GO:0120036	0.720	plasma membrane bounded cell projection organization
GO:0050896	0.684	response to stimulus
GO:0040007	0.672	growth
GO:0031175	0.652	neuron projection development
GO:0007154	0.636	cell communication
GO:0023052	0.635	signaling
GO:1990138	0.597	neuron projection extension
GO:0048675	0.591	axon extension
GO:0051716	0.551	cellular response to stimulus
GO:0007165	0.544	signal transduction
GO:0048518	0.524	positive regulation of biological process
GO:0048519	0.504	negative regulation of biological process
GO:0048522	0.477	positive regulation of cellular process
GO:0048583	0.455	regulation of response to stimulus
GO:0051239	0.454	regulation of multicellular organismal process
GO:0048523	0.452	negative regulation of cellular process
GO:0050793	0.446	regulation of developmental process
GO:0023051	0.400	regulation of signaling
GO:0010646	0.378	regulation of cell communication
GO:0009966	0.363	regulation of signal transduction
GO:0040012	0.317	regulation of locomotion
GO:0007155	0.300	cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.984	cell periphery
GO:0043226	0.939	organelle
GO:0005886	0.936	plasma membrane
GO:0005576	0.928	extracellular region
GO:0043227	0.919	membrane-bounded organelle
GO:0005615	0.786	extracellular space
GO:0005622	0.630	intracellular anatomical structure
GO:0031982	0.535	vesicle
GO:0043229	0.410	intracellular organelle
GO:1903561	0.341	extracellular vesicle
GO:0070062	0.324	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]