StarFunc result for job id Q13595

User Input

>input (282 residues)
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1WC25	0.434	0.434	6.883E-42	282	0.989	0.989	B1WC25.pdb.gz	B1WC25_RAT Tra2a protein OS=Rattus norvegicus OX=10116 GN=Tra2a PE=1 SV=1
2	AFDB:P62995	0.404	0.397	1.853E-29	288	0.695	0.681	P62995.pdb.gz	TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1
3	AFDB:P19018	0.374	0.394	5.357E-18	264	0.397	0.424	P19018.pdb.gz	TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster OX=7227 GN=tra2 PE=1 SV=1
4	AFDB:J7FTI7	0.280	0.480	1.494E-12	162	0.213	0.370	J7FTI7.pdb.gz	J7FTI7_HORVU RBP1 OS=Hordeum vulgare OX=4513 GN=rbp1 PE=1 SV=1
5	AFDB:W8E7I1	0.279	0.487	2.365E-12	160	0.223	0.394	W8E7I1.pdb.gz	RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus OX=9925 GN=RBM3 PE=2 SV=2
6	AFDB:Q43472	0.306	0.522	2.697E-12	161	0.191	0.335	Q43472.pdb.gz	GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare OX=4513 GN=blt801 PE=1 SV=1
7	AFDB:A0A0A0LLY1	0.282	0.492	4.270E-12	160	0.202	0.356	A0A0A0LLY1.pdb.gz	SRBP1_CUCSA Small RNA binding protein 1 OS=Cucumis sativus OX=3659 GN=SRBP1 PE=1 SV=1
8	AFDB:O93235	0.280	0.471	4.560E-12	166	0.223	0.380	O93235.pdb.gz	CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis OX=8355 GN=cirbp-a PE=1 SV=2
9	AFDB:Q9PTX2	0.276	0.469	5.552E-12	164	0.230	0.396	Q9PTX2.pdb.gz	CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeianus OX=8400 GN=cirbp PE=2 SV=1
10	AFDB:Q9SIX3	0.271	0.503	1.002E-11	149	0.184	0.349	Q9SIX3.pdb.gz	RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=RBG1 PE=2 SV=2
11	PDB:6qx91K	0.281	0.391	2.668E-10	201	0.128	0.179	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:7dvqY	0.292	0.570	2.042E-9	140	0.110	0.221	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:5yzg1	0.274	0.317	5.836E-9	243	0.096	0.111	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:5oobB	0.285	0.517	8.104E-9	152	0.099	0.184	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
15	PDB:3lqvB	0.266	0.638	1.125E-8	115	0.082	0.200	3lqvB.pdb.gz	Branch Recognition by SF3b14
16	PDB:6y53o	0.264	0.460	1.562E-8	160	0.085	0.150	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
17	PDB:6zmwo	0.264	0.913	2.642E-8	77	0.096	0.351	6zmwo.pdb.gz	Structure of a human 48Stranslational initiation complex.
18	PDB:1hl6A	0.279	0.645	4.466E-8	119	0.099	0.235	1hl6A.pdb.gz
19	PDB:5xjcw	0.275	0.825	5.807E-8	91	0.096	0.297	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
20	PDB:5gm6V	0.281	0.606	6.201E-8	128	0.089	0.195	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8J8Y9E0	0.0	512	280	0.986	0.993	A0A8J8Y9E0_RAT Transformer 2 alpha homolog OS=Rattus norvegicus OX=10116 GN=Tra2a PE=1 SV=1
2	B1WC25	0.0	520	282	0.993	0.993	B1WC25_RAT Tra2a protein OS=Rattus norvegicus OX=10116 GN=Tra2a PE=1 SV=1
3	Q13595	0.0	534	282	1.000	1.000	TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1
4	Q549U1	0.0	534	282	1.000	1.000	Q549U1_HUMAN Putative MAPK activating protein OS=Homo sapiens OX=9606 GN=HSU53209 PE=2 SV=1
5	Q6PFR5	0.0	511	281	0.986	0.989	TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus OX=10090 GN=Tra2a PE=1 SV=1
6	A0A8I5ZXL0	1.16e-96	286	258	0.592	0.647	A0A8I5ZXL0_RAT Transformer 2 alpha homolog OS=Rattus norvegicus OX=10116 GN=Tra2a PE=4 SV=1
7	P62995	1.09e-75	234	288	0.440	0.431	TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1
8	P62996	1.09e-75	234	288	0.440	0.431	TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus OX=10090 GN=Tra2b PE=1 SV=1
9	P62997	1.09e-75	234	288	0.440	0.431	TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus OX=10116 GN=Tra2b PE=1 SV=1
10	P19018	1.83e-37	135	264	0.248	0.265	TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster OX=7227 GN=tra2 PE=1 SV=1
11	Q54Y98	4.60e-23	98.6	326	0.248	0.215	TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum OX=44689 GN=tra2 PE=3 SV=1
12	K7EMY9	2.42e-20	87.4	159	0.152	0.270	K7EMY9_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
13	Q14011	2.46e-20	87.8	172	0.152	0.250	CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
14	Q53XX5	2.46e-20	87.8	172	0.152	0.250	Q53XX5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=2 SV=1
15	K7EPM4	3.17e-20	87.4	168	0.152	0.256	K7EPM4_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
16	P60824	4.08e-20	87.0	172	0.152	0.250	CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus OX=10090 GN=Cirbp PE=1 SV=1
17	P60825	4.08e-20	87.0	172	0.152	0.250	CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Cirbp PE=2 SV=1
18	D6W5Y5	2.24e-19	87.8	297	0.152	0.145	D6W5Y5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
19	H7C2L4	2.35e-18	80.5	107	0.160	0.421	H7C2L4_HUMAN Transformer 2 beta homolog (Fragment) OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1
20	Q9DED4	1.54e-17	80.1	166	0.142	0.241	CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis OX=8355 GN=cirbp-b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10351 Apt1	2.2e+02	12.1	Golgi-body localisation protein domain
2	PF00076 RRM_1	2.6e-16	70.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010639422.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010618541.1	0.949	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
2	885580.XP_010637127.1	0.913	Serine/arginine-rich splicing factor 3
3	885580.XP_010603269.1	0.909	Serine/arginine-rich splicing factor 7 isoform X1
4	885580.XP_010624250.1	0.893	Serine/arginine-rich splicing factor 10 isoform X1
5	885580.XP_010643724.1	0.766	RNA-binding protein 25
6	885580.XP_010626562.1	0.762	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
7	885580.XP_010612767.1	0.760	U1 small nuclear ribonucleoprotein A
8	885580.XP_010617027.1	0.744	Serine/arginine-rich splicing factor 2
9	885580.XP_010602084.1	0.739	Splicing factor 3A subunit 1
10	885580.XP_010630307.1	0.725	Serine/arginine-rich splicing factor 4
11	885580.XP_010626238.1	0.712	Pleiotropic regulator 1
12	885580.XP_010621932.1	0.704	Pre-mRNA-processing factor 40 like protein B
13	885580.XP_010629807.1	0.701	Serine/arginine-rich splicing factor 6
14	885580.XP_010631917.1	0.701	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
15	885580.XP_010602210.1	0.698	Small nuclear ribonucleoprotein Sm D3
16	885580.XP_010603981.1	0.697	Heterogeneous nuclear ribonucleoprotein M
17	885580.XP_010621868.1	0.695	Putative ATP-dependent RNA helicase DDX23
18	885580.XP_010622511.1	0.692	Transformer-2 protein homolog beta
19	885580.XP_010631594.1	0.691	Serine/arginine-rich splicing factor 12
20	885580.XP_010601869.1	0.690	Serine/arginine repetitive matrix protein 2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.693	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0050794	0.983	regulation of cellular process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0043170	0.969	macromolecule metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0034641	0.961	cellular nitrogen compound metabolic process
GO:0008380	0.947	RNA splicing
GO:1903311	0.922	regulation of mRNA metabolic process
GO:0043484	0.896	regulation of RNA splicing
GO:0000375	0.895	RNA splicing, via transesterification reactions
GO:0000398	0.880	mRNA splicing, via spliceosome
GO:0048518	0.816	positive regulation of biological process
GO:0010604	0.770	positive regulation of macromolecule metabolic process
GO:0010628	0.740	positive regulation of gene expression
GO:0048522	0.611	positive regulation of cellular process
GO:0051173	0.522	positive regulation of nitrogen compound metabolic process
GO:0031325	0.500	positive regulation of cellular metabolic process
GO:0048024	0.485	regulation of mRNA splicing, via spliceosome
GO:0033120	0.472	positive regulation of RNA splicing
GO:1903313	0.320	positive regulation of mRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005737	0.690	cytoplasm
GO:0032991	0.651	protein-containing complex
GO:0005730	0.418	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]